2.7 Carat Cushion Cut Lab Created Blue Sapphire Diamond Infinity Necklace

0
Sale price $347 Regular price $399
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Create a memorable moment with this lovely Blue Sapphire Infinity Pendant, designed to captivate the heart of any woman. It features 8 MM cushion cut lab created blue sapphire set in prong setting, complemented by round brilliant cut lab grown diamond on the infinity motif, symbolizing everlasting love. Hanging from a chain, this Blue Sapphire Pendant showcases a simple yet sophisticated design that draws attention and invites compliments. With its minimalistic style, this Infinity Love Necklace represents the bond between two people and the concept of eternity, with no beginning or end. It serves as a heartfelt and sentimental gift for that special someone, expressing your infinite love. Its simplicity and elegance shine through its minimalistic charm. The infinity symbol adds a touch of sophistication and can be paired with any outfit. This chic yet romantic Blue Sapphire and Diamond Necklace is the perfect way to convey that your love for those dear to you is boundless and timeless.

Product Information
SKU SHP-PENDANT042159822
Length 21 mm
Width 8.8 mm
Metal Weight 3.78 gm (Approximate)
Total Stone Weight 2.84 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 2.75 Carat (Approximate)
Dimension(approx) Cushion-8X8 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Cushion
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.09 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-1 Pcs
Round-1.30X1.30 mm-1 Pcs
Round-1.40X1.40 mm-6 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-created-blue-sapphire-necklace