Vintage inspired Ethiopian Opal Stud Earrings with Diamond Accent

0
Sale price $711 Regular price $799
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Sparkle in style with these beautiful Ethiopian Opal Stud Earrings. Featuring a 4 MM round cut Ethiopian opal in the center of a petal motif, surrounded by sparkling lab grown diamond stones. These Vintage Opal Earrings are a must have, they are the perfect blend of sophistication and glamour, perfect for adding a touch of glam to any outfit. Give the gift of shine with these gorgeous October Birthstone Earrings, sure to make any woman feel special and loved. The screw back design keeps them secure and comfortable, so you can wear them all day or for special occasions. The opal and lab grown diamond stones make them great for dinner dates, parties, or everyday use. These Designer Earrings match well with casual clothes, evening outfits, or formal looks, adding an instant touch of style. They also come in a nice jewelry box with a certificate of authenticity, making them a thoughtful gift. With their safe fit, classic design, and beautiful stones, these Opal and Diamond Earrings are a lovely addition to any jewelry collection, bringing color, elegance, and sparkle for years.

Product Information
SKU SHP-EARRINGS042210082
Metal Weight 1.50 gm (Approximate)
Total Stone Weight 0.74 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 2 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-4X4 mm-2 Pcs
Color Rainbow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.24 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-10 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1.50X1.50 mm-4 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
opal-earrings