Simple Moissanite Infinity Jewelry Set

0
Regular price $2,139
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbol of Forever in a Refined Set

This Simple Moissanite Infinity Jewelry Set is created for those who appreciate meaningful design expressed through clean, wearable forms. The infinity motif represents continuity and lasting connection, making it a thoughtful choice for gifting or personal wear.

Its coordinated design ensures a balanced look, whether worn together or styled individually.

Infinity Design with Subtle Sparkle

The infinity symbol’s flowing curves create a soft, uninterrupted silhouette. Moissanite accents are integrated to enhance the lines of the motif, adding light reflection without overwhelming the minimalist aesthetic.

The simplicity of the design allows the symbolic form to remain the focal point.

Moissanite for Everyday Brilliance

Moissanite is valued for its strong light performance and durability, making it suitable for jewelry intended for regular wear. Its sparkle complements the infinity structure while maintaining a refined appearance.

Moissanite is created without traditional mining, though impact varies by production and energy source.

High-Level Features

This jewelry set features a coordinated infinity design accented with moissanite. The pieces are crafted to offer symbolic meaning, balanced sparkle, and versatile styling for everyday use or special occasions.

Product Information
SKU SHP-PENDANT072210138
Length 28.5 mm
Width 9.5 mm
Height 1.6 mm
Metal Weight 6.50 gm (Approximate)
Total Stone Weight 0.80 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 95 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-39 Pcs
Round-1X1 mm-56 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
infinity-jewelry

FAQs About: Simple Moissanite Infinity Jewelry Set

What does the infinity symbol represent in jewelry?
The infinity symbol commonly represents eternity, continuity, and lasting connection, making it a meaningful motif for personal wear or gifting.
Can the pieces in this infinity jewelry set be worn separately?
Yes, the coordinated pieces can be styled together for a unified look or worn individually for subtle, everyday elegance.
Is moissanite suitable for daily wear jewelry?
Moissanite is known for its durability and light performance, making it appropriate for jewelry that is worn regularly.
Is this infinity jewelry set appropriate as a gift?
Yes, the infinity motif and coordinated design make it a thoughtful option for anniversaries, birthdays, or meaningful milestones.
How should I care for a moissanite jewelry set?
Clean gently using mild soap and lukewarm water with a soft cloth or brush, then dry thoroughly before storing to maintain shine.