Round Shape Moissanite Cluster Flower Engagement Ring

0
Regular price $959
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the beauty of nature, this Flower Engagement Ring brings a soft, romantic glow to your most meaningful moments. At the center of this enchanting design is a delicate cluster of high quality round cut moissanites, expertly arranged to form a blooming flower that sparkles from every angle. The result is a ring that feels both fresh and timeless - perfect for those who adore elegance with a whimsical touch. The floral motif gives this Cluster Engagement Ring a graceful and feminine vibe, capturing the spirit of love in full bloom. The clustered style enhances the brilliance and creates the look of a larger centerpiece, while still offering a lightweight, comfortable feel for everyday wear. Crafted with precision and designed to last, this Moissanite Engagement Ring blends classic style with playful beauty, ideal for women who love fine jewelry that feels personal and expressive. The shimmering moissanites reflect light beautifully, offering an ethical, sustainable alternative without compromising on shine. Packaged in a lovely jewelry box, it is ready to be gifted or cherished as a keepsake that marks a love that continues to grow. Let this Moissanite Flower Ring be a lasting reminder that love, like flowers, blossoms with care and intention.

Product Information
SKU SHP-RINGS0821190403
Width 11.8 mm
Height 4.5 mm
Metal Weight 1.84 gm (Approximate)
Total Stone Weight 0.80 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 7 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-3X3 mm-7 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings