Round Moissanite Infinity Wedding Band for Women

0
Sale price $1,104 Regular price $1,269
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

A single infinity symbol marks a bond, but multiple symbols say it is unbreakable. This Infinity Wedding Band is a beautiful way to express lasting love and commitment. Designed with the delicate curves of the infinity symbol, it features round D-VS1 quality moissanite stones, each securely prong set. The pattern flows continuously around half of the band, representing a bond that has no beginning or end. The infinity motif adds a meaningful touch to the design, making it more than just a piece of jewelry, it is a symbol of connection, strength, and forever. Ideal for gifting on Valentine’s Day or marking a special milestone, this Moissanite Eternity Band speaks the language of love in a timeless and elegant form. Whether worn alone or stacked with other rings, this Half Eternity Wedding Band brings a graceful glow to everyday wear. Comfortable and versatile, it is perfect for daily use while still eye-catching enough for special occasions. It comes complete with a gemstone authentication certificate and is packaged in an elegant jewelry box, ready to gift, cherish, or celebrate a lasting bond. For those seeking a meaningful, radiant, and modern alternative to diamond, this Infinity Moissanite Ring captures the essence of everlasting love in a design that is both stylish and symbolic.

Product Information
SKU SHP-RINGS0821206609
Width 5.7 mm
Height 2.5 mm
Metal Weight 3.40 gm (Approximate)
Total Stone Weight 1.26 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 14 Pieces
Total Weight 1.26 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-14 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
infinity-jewelry