Round Fire Opal Leaf Promise Ring with Diamond

0
Regular price $779
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

There is something instantly eye-catching about this Fire Opal Promise Ring - it has that glowing vibe that feels full of life. At the center sits a round cut fire opal, secured in prong setting that lets the stone show off all its natural flashes. The band is where the design really comes alive. It features a leaf branch pattern, with tiny sparkling diamond accents placed along the leaf motifs. The nature-inspired design gives it a gentle and organic feel, almost like a vine wrapping around your finger. There is also fine beaded detailing along the band that adds texture. It blends that vintage-style charm with a slightly modern finish, so this Fire Opal and Diamond Ring does not feel old-fashioned, just thoughtfully detailed. Symbolically, the fire opal is often linked to passion, energy, and creativity, while the leaf motif represents growth and new beginnings. Together, they make this Leaf Promise Ring feel more than just pretty, it carries a story. It is lightweight, comfortable, and easy to wear, whether you are dressing up or keeping things casual. Plus, this Orange Opal Ring comes in a jewelry box with a certificate of authenticity, so it is ready to gift or keep as a meaningful piece for yourself.

Product Information
SKU SHP-RINGS0821200136
Width 2.8 mm
Height 3.7 mm
Metal Weight 1.26 gm (Approximate)
Total Stone Weight 0.47 Carat (Approximate)
FIRE OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Orange
Cut Brilliant
Shape Round
Setting Type 6-Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.02 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 6-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
fire-opal-rings