Round Fire Opal Flower Engagement Ring with Diamond

0
Regular price $839
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Unique Expression of Love Through Color

This fire opal flower engagement ring is designed for those who want their proposal to feel distinctive and deeply personal. The vibrant hue of the center stone introduces warmth and individuality, offering a refreshing alternative to traditional styles.

Its design speaks to those who value expressive jewelry that still maintains a refined and elegant presence.

Floral Design with Purposeful Detail

The flower-inspired setting is crafted to frame the center stone in a balanced and visually harmonious way. Each element is placed to enhance the overall structure, creating a soft yet structured appearance.

This design approach adds dimension while keeping the ring wearable and thoughtfully composed.

Fire Opal for Vibrant Character

Fire opal is appreciated for its vivid color and lively appearance, making it a compelling choice for those seeking something beyond conventional gemstones. Its natural brightness adds personality without requiring additional embellishment.

The gemstone offers a distinctive look that stands out while remaining versatile for different personal styles.

Subtle Diamond Accents for Balance

Diamond details are incorporated to introduce gentle brilliance, complementing the center stone rather than competing with it. This balance ensures that the overall design feels cohesive and refined.

The contrast between the colored gemstone and diamond accents enhances visual depth.

Designed for Comfortable Wear

The ring is structured to sit comfortably on the finger, making it suitable for regular wear. Its thoughtful proportions help maintain both style and ease throughout daily use.

This makes it a practical yet distinctive choice for an engagement ring.

A Modern Take on a Timeless Symbol

Combining a floral motif with a vibrant gemstone, this ring offers a modern interpretation of a classic engagement concept. It is well suited for those who want a piece that reflects both individuality and lasting meaning.

The design bridges tradition and creativity, making it a memorable choice for marking a significant moment.

Product Information
SKU SHP-RINGS032224035
Width 9.7 mm
Height 4 mm
Weight 1.92 gm (Approximate)
FIRE OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.75 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Orange
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-1.80X1.80 mm-6 Pcs
Round-2.40X2.40 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
fire-opal-engagement-rings

Faq About: Round Fire Opal Flower Engagement Ring with Diamond

Is fire opal a good choice for an engagement ring?
Fire opal is chosen for its vibrant color and unique appearance, making it a distinctive option for those seeking a non-traditional engagement ring.
Can this ring be worn daily?
The ring is designed for regular wear, though careful handling is recommended to maintain its appearance over time.
What makes the floral design unique?
The flower-inspired setting frames the center stone in a balanced way, adding visual depth while keeping the overall look refined.
Do the diamond accents overpower the opal?
No, the diamond accents are designed to enhance the center stone subtly, providing sparkle without taking focus away from the opal.
Is this ring suitable for proposals?
Yes, its unique design and meaningful appearance make it a thoughtful choice for proposals and special occasions.
How should I care for a fire opal ring?
It is best to clean it gently and store it separately to help preserve its color and surface over time.