Round Cut Solitaire Amethyst Flower Promise Ring

0
Sale price $1,005 Regular price $1,129
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Amethyst Flower Ring is a classic piece of jewelry that has stood the test of time and is adored by royalty. With its romantic design, this iconic royal ring showcases floral motifs. Crafted with great attention to detail, this Nature Inspired Ring features a 5 MM Round Shape Amethyst set in Prong Setting and surrounded by metal flower pattern. This Flower Promise Ring is a true work of art, displaying intricate designs that mimic a blooming flower with its delicate petals. The AAA Quality Amethyst sparkles brilliantly, capturing natures beauty while exuding romance and femininity, making it an ideal choice for an engagement ring or to celebrate a milestone. Its timeless design has surpassed trends, being cherished for many years, and boasts a classic aesthetic. Flowers symbolize love, growth, and new beginnings, making them an excellent motif for an engagement ring, resulting in a truly unique piece of jewelry. This exquisite Amethyst Proposal Ring is perfect for anyone seeking something with a touch of extra sparkle. It is a beautifully crafted piece that is guaranteed to attract attention and radiate luxurious royalty.

Product Information
SKU SHP-RINGS082223749
Metal Weight 2.87 gm (Approximate)
Total Stone Weight 0.45 Carat (Approximate)
AMETHYST INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Violet
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
View More

Product Parent Collection Handle
amethyst-rings