Round Cut Black Onyx and Diamond Flower Engagement Ring

0
Regular price $979
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Bold Black Onyx Flower Engagement Ring

This Round Cut Black Onyx and Diamond Flower Engagement Ring is crafted for those who prefer distinctive elegance over traditional sparkle. The round black onyx center stone offers a deep, dramatic presence, while the surrounding floral-inspired design introduces softness and symbolism. It is an expressive choice for an engagement ring that stands apart.

Floral Setting with Diamond Accents

The flower-style arrangement frames the black onyx with carefully placed diamond accents, creating contrast and dimension. The diamonds add subtle brilliance that highlights the dark center stone without overwhelming it. This balanced design ensures the ring feels both artistic and refined.

The Character of Black Onyx

Black onyx is admired for its smooth surface and rich, opaque color. Its bold appearance makes it a striking centerpiece in fine jewelry. With proper care and mindful wear, black onyx can be enjoyed as a distinctive gemstone choice for engagement and statement rings.

Designed for Individual Expression

The combination of a round silhouette and floral motif creates a harmonious yet unconventional engagement ring style. This ring can be worn alone as a signature piece or paired with complementary bands for a coordinated look. The overall aesthetic emphasizes contrast, symbolism, and thoughtful craftsmanship.

Product Information
SKU SHP-RINGS0821169280
Width 4.5 mm
Height 9.2 mm
Metal Weight 2.13 gm (Approximate)
Total Stone Weight 0.51 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type 4-Claw-Prong-Diagonal-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.06 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-8 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 4-Claw-Prong-Diagonal-Setting
Quality Grade SI
View More

Product Parent Collection Handle
black-onyx-rings

FAQs About: Round Cut Black Onyx and Diamond Flower Engagement Ring

Is black onyx suitable for an engagement ring?
Black onyx can be chosen for engagement rings by those seeking a bold and distinctive look. It should be worn with care to help maintain its surface over time.
What does a flower design symbolize in an engagement ring?
Floral designs often symbolize growth, beauty, and new beginnings, making them meaningful for engagement jewelry.
Do the diamonds enhance the black onyx center stone?
Yes. The diamond accents provide light contrast and subtle brilliance, helping the black onyx remain the focal point of the design.
Can this ring be worn daily?
With mindful care, this ring can be worn regularly. Removing it during activities that may cause impact helps preserve the gemstone and setting.
How should I clean this black onyx ring?
Clean gently using mild soap, lukewarm water, and a soft cloth. Avoid harsh chemicals and store separately to maintain the gemstone and metal finish.