Round Certified Moissanite Flower Engagement Ring

0
Regular price $1,369
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral-Inspired Engagement Ring

This round certified moissanite flower engagement ring is designed for those who appreciate nature-inspired details with refined brilliance. The floral motif frames the center stone, creating a soft and romantic silhouette.

The round moissanite at the heart of the design delivers light performance that enhances the petal-like arrangement around it.

Flower Setting with Structured Sparkle

The flower-style setting arranges surrounding elements to resemble delicate petals, giving dimension and visual depth to the ring’s profile. This design adds character while maintaining balance and symmetry.

The round cut center stone supports even light reflection, contributing to a timeless engagement look.

Certified Moissanite Center

Certified moissanite is valued for its brightness and fire. As a lab-created gemstone, it is created without traditional mining, though impact varies by production and energy source.

Its durability and clarity make it a practical choice for engagement jewelry intended for regular wear.

High-Level Features

This engagement ring features a round certified moissanite center arranged within a floral-inspired setting. The design emphasizes symmetry, brilliance, and delicate detailing suited for a meaningful proposal.

Product Information
SKU SHP-RINGS082218839
Width 3.8 mm
Height 11 mm
Metal Weight 3.70 gm (Approximate)
Center Stone Weight 0.99 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 29 Pieces
Total Weight 1.48 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Round-1.50X1.50 mm-12 Pcs
Round-1.10X1.10 mm-16 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-engagement-rings

FAQs About: Round Certified Moissanite Flower Engagement Ring

What defines a flower engagement ring design?
A flower engagement ring features a setting arranged to resemble petals around the center stone, creating a floral-inspired appearance.
Why is a round cut used for this moissanite?
The round cut is known for balanced brilliance and symmetry, making it well-suited for detailed settings such as floral designs.
What does certification mean for moissanite?
Certification verifies the authenticity and quality characteristics of the moissanite used in the ring.
Is a floral setting suitable for everyday wear?
When crafted securely, a floral setting can be worn regularly with mindful care.
Can this ring be paired with a straight wedding band?
Pairing options depend on the ring’s profile and setting height, and many floral designs can complement a straight or contoured band.