Round Black Spinel Sunburst Promise Ring for Women

0
Sale price $266 Regular price $299
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Give a meaningful promise a distinctive form with this Genuine Black Spinel Sunburst Promise Ring for Women. A round black spinel sits at the heart of a radiating sunburst motif, creating a striking contrast between its dark center and sculpted metal rays. Compact and symbolic, this black spinel promise ring is suited to commitments, anniversaries, fresh beginnings, or a personal gift with lasting significance.

Genuine Black Spinel Sunburst Promise Ring in Sterling Silver

The design centers one approximately 0.09 carat black spinel measuring 3 x 3 mm. Its round shape, brilliant cut, AAA quality, and four-prong diagonal setting keep the gemstone clearly defined within the sunburst design. Crafted in 92.5 sterling silver, the ring measures approximately 6.2 mm in width and 1.8 mm in height, with an approximate metal weight of 2.00 grams.

What Makes This Black Spinel Sunburst Ring Special

  • One genuine round black spinel weighing approximately 0.09 carat.
  • Compact 3 x 3 mm gemstone with brilliant-cut faceting.
  • AAA quality black spinel with a deep black appearance.
  • Four-prong diagonal setting keeps the center stone visually defined.
  • Radiating sunburst motif creates contrast around the dark gemstone.
  • Rounded band supports a streamlined, easy-to-style profile.
  • Approximately 6.2 mm wide and 1.8 mm high.
  • Crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate weight of 2.00 grams.

Meaning Behind the Black Spinel Sunburst Promise Ring

The contrast between the dark black spinel and outward-reaching sunburst rays gives this promise ring a strong symbolic character. The radiating design can evoke light, optimism, and a new chapter, while the promise-ring format makes it especially fitting for expressing commitment or marking an important relationship milestone. Its understated center stone keeps the symbolism personal rather than overly ornate.

Black Spinel Ring Authenticity & Craftsmanship

Rosec Jewels crafts this promise ring with attention to gemstone alignment, secure prong placement, balanced sunburst detailing, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to help maintain the gemstone and metal finish.

Styling the Black Spinel Promise Ring for Women

The compact 3 mm black spinel gives the ring a defined focal point without creating an oversized profile, making it easy to wear alone or alongside simple bands. Its sunburst face adds visual interest from above, while the low 1.8 mm height keeps the design streamlined. Wear it as a commitment ring, anniversary gift, everyday symbolic piece, or meaningful addition to a personal ring stack.

Product Information
SKU SHP-RINGS0821209822
Width 6.2 mm
Height 1.8 mm
Metal Weight 2.00 gm (Approximate)
Total Stone Weight 0.09 Carat (Approximate)
BLACK SPINEL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.09 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type 4-Prong-Diagonal-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-spinel-rings

FAQs About: Genuine Black Spinel Sunburst Promise Ring for Women

What size is the black spinel in this promise ring?

The ring features one round black spinel measuring approximately 3 x 3 mm and weighing about 0.09 carat.

What cut and quality is the black spinel gemstone?

The black spinel has a round shape, brilliant cut, and AAA quality grade. Its dark center creates a strong contrast with the surrounding sunburst design.

How is the black spinel secured in the sunburst ring?

The 3 mm round black spinel is secured in a four-prong diagonal setting, keeping the gemstone centered and clearly visible within the radiating motif.

What does the sunburst promise ring design represent?

The radiating sunburst form can represent light, optimism, and new beginnings. Combined with the promise-ring design, it creates a meaningful choice for commitment, anniversaries, relationship milestones, or personal symbolism.

What metal is used for this black spinel promise ring?

The confirmed ring is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 2.00 grams. The design measures about 6.2 mm wide and 1.8 mm high.

Does the black spinel ring come with a Certificate of Authenticity?

Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for a black spinel promise ring?

Clean the ring gently with mild soap, lukewarm water, and a soft cloth or brush, then rinse and dry it carefully. Avoid harsh chemicals and abrasive surfaces, store the ring separately when not worn, and periodically check the prongs for secure wear.