Real Marquise Tanzanite Diamond Engagement Ring with Celtic Knot

0
Regular price $1,119
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Marquise Tanzanite with Symbolic Detail

This real marquise tanzanite diamond engagement ring with Celtic knot design combines expressive color with meaningful craftsmanship. The marquise cut center stone features elongated lines and pointed ends that create a graceful, lengthening effect on the finger.

Its vivid blue-violet tanzanite is complemented by diamond accents, offering a balanced interplay of color and light.

Celtic Knot Inspired Setting

The Celtic knot motif woven into the band represents continuity and interconnectedness, adding depth and symbolism to the design. The intricate metalwork enhances the overall character of the ring while maintaining structural integrity.

This detailing gives the piece a distinctive identity, making it especially meaningful for those who value heritage-inspired patterns.

Natural Tanzanite and Diamond Accents

Tanzanite is admired for its unique spectrum of blue and violet hues, offering a striking alternative to traditional engagement stones. The marquise cut emphasizes its color while highlighting its elegant proportions.

Diamond accents add refined brilliance, enhancing the center stone without overpowering its presence. With mindful care, this combination can be enjoyed as part of everyday wear.

A Distinctive Engagement Choice

This ring is well suited for someone who appreciates symbolic design, elongated gemstone shapes, and a touch of heritage-inspired artistry in fine jewelry. It offers a balance of romance, individuality, and thoughtful craftsmanship.

Product Information
SKU SHP-RINGS052184024
Width 2.6 mm
Height 9 mm
Metal Weight 2.40 gm (Approximate)
Center Stone Weight 0.68 Carat (Approximate)
TANZANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.68 Carat (Approximate)
Dimension(approx) Marquise-4X8 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tanzanite-rings

FAQs About: Marquise Tanzanite Celtic Knot Ring

What does a Celtic knot symbolize in a ring design?
A Celtic knot traditionally represents eternity and interconnectedness, making it a meaningful motif for engagement jewelry.
What are the benefits of a marquise cut gemstone?
The marquise cut features elongated proportions that can create a flattering, lengthening effect on the finger while showcasing vibrant gemstone color.
How does tanzanite compare to other engagement stones?
Tanzanite is valued for its distinctive blue-violet color and rarity, offering a unique alternative to more traditional clear gemstones.
Are diamond accents suitable for daily wear?
Diamonds are known for their durability and help add balanced sparkle, making them a practical complement to a colored center stone.
Who is this engagement ring best suited for?
This design is ideal for someone who values symbolic detailing, distinctive gemstone shapes, and a meaningful alternative to traditional engagement styles.