Real Emerald Statement Flower Pendant Necklace with Diamond

0
Sale price $1,373 Regular price $1,509
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Statement Pendant with Natural Elegance

This real emerald statement flower pendant necklace is created for those who appreciate distinctive design with a refined finish. The floral motif introduces a sense of movement and softness, making it suitable for both special occasions and elevated everyday styling.

It is an ideal choice for buyers looking for a piece that feels expressive yet remains balanced and wearable.

Floral Design with Structured Detailing

The flower-inspired arrangement is carefully composed to create symmetry while allowing each element to contribute to the overall visual impact. The placement of stones enhances depth and dimension, giving the pendant a layered appearance without overwhelming the design.

This thoughtful structure ensures a timeless look that remains versatile across different trends.

Designed for Comfortable Wear

The pendant is proportioned to sit naturally along the neckline, offering a secure and comfortable fit. Its construction allows it to remain stable while worn, making it suitable for extended use throughout the day.

This balance between presence and comfort makes it easy to incorporate into regular wear.

Natural Emerald as the Centerpiece

Emerald is valued for its rich green color and distinctive character, offering a look that stands apart from more traditional stones. Its natural formation gives each piece a unique visual identity.

As a gemstone, emerald is often chosen for designs that prioritize individuality and color-driven appeal.

Versatility Across Styling Choices

The floral pendant design allows it to function as a statement piece while still pairing well with different outfits. It can be worn alone to highlight its design or layered with other necklaces for a more personalized look.

This flexibility makes it suitable for both minimal and more expressive styling preferences.

A Considered Gift Option

With its combination of natural gemstone and floral design, this pendant offers a thoughtful gifting choice. It carries both visual appeal and symbolic meaning, making it suitable for occasions where personal significance matters.

Its design ensures it remains relevant and wearable over time.

Product Information
SKU SHP-PENDANT112035285
Length 22 mm
Width 15.4 mm
Weight 4.00 gm (Approximate)
Center Stone Weight 0.50 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 9 Pieces
Total Weight 2.08 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-8 Pcs
Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 22 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-8 Pcs
Round-1.40X1.40 mm-14 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
emerald-necklace

Faq About: Real Emerald Statement Flower Pendant Necklace with Diamond

Is this pendant suitable for everyday wear?
Yes, it is designed with a balanced structure that allows for comfortable and regular use.
What makes the flower design unique?
The floral arrangement creates depth and visual interest, offering a distinctive look compared to traditional pendant styles.
Will the pendant feel heavy on the neck?
The design is crafted to provide presence while maintaining a comfortable and lightweight feel.
Can this necklace be layered with other pieces?
Yes, its design allows it to be styled alone or combined with other necklaces for a layered look.
Is emerald a durable gemstone for jewelry?
Emerald is suitable for jewelry, though it is best worn with care to maintain its appearance over time.
Is this pendant a good gift choice?
Yes, its natural gemstone and floral design make it a thoughtful option for meaningful gifting occasions.