Real Diamond Infinity Tragus Earring for Women

0
Sale price $436 Regular price $479
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate elegance and individuality with the Diamond Infinity Earring, a piece that combines timeless design with dazzling sparkle. The earring features round cut diamonds set in prong setting on a graceful infinity motif, symbolizing eternal love, strength, and connection. Each diamond is carefully selected for HI color and SI clarity, ensuring that the piece catches light beautifully from every angle. Crafted from hallmarked metal, this Diamond Tragus Earring offers both durability and a luxurious finish, making it a lasting addition to any jewelry collection. Designed for versatility, it can be worn on multiple ear piercings, including the helix, cartilage, tragus, conch, or upper lobe, allowing for a personalized look that expresses your unique style. The flat back closure provides a secure and comfortable fit, so it stays in place throughout the day while maintaining its radiant appearance. This Diamond Helix Earring is not only a stunning accessory but also an ideal gift for special occasions, whether it is a birthday, anniversary, or celebration of personal milestones. Each earring is handcrafted with attention to detail and comes with a certificate, ensuring superior quality and authenticity. Delivered in a premium jewelry box, it is ready to impress and delight the recipient from the moment it is presented.

Product Information
SKU SHP-BODYJ022210079
Length 7 mm
Width 2.3 mm
Height 2.3 mm
Metal Weight 0.40 gm (Approximate)
Total Stone Weight 0.03 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.03 Carat (Approximate)
Dimension(approx) Round-1X1 mm-5 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tragus-earrings