Real 0.9 Carat Blue Sapphire Rose Flower Engagement Ring with Diamond Bypass Shank

0
Regular price $1,629
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bring more charm to your love story with this enchanting Flower Engagement Ring, beautifully designed to celebrate romance in the most elegant way. At the center shines a captivating 5 mm Round Shape Blue Sapphire set in Prong Setting at the center of a graceful Rose Flower Motif that symbolizes blooming love, beauty and new beginnings. The rich AAA Quality Blue Sapphire is admired for representing loyalty and lifelong commitment, making this Blue Sapphire Engagement Ring a meaningful expression of true devotion. Adding even more brilliance, the elegant Bypass Shank is adorned with dainty Diamond stones that create a sparkling flow around the finger, symbolizing two souls coming together on one beautiful journey. Perfect as an engagement ring, anniversary gift, promise ring or a heartfelt surprise for someone special, this Nature Inspired Engagement Ring captures emotions that words often cannot express. Its timeless beauty makes it ideal for everyday elegance as well as unforgettable celebrations. Thoughtfully crafted to create lasting memories, this stunning Blue Sapphire Diamond Ring arrives in a signature jewelry box ready for gifting. Available in various ring sizes, choose the perfect fit to express eternal love with grace, sparkle and unforgettable beauty.

Product Information
SKU SHP-RINGS0821192900
Width 5 mm
Height 11.5 mm
Metal Weight 3.22 gm (Approximate)
Center Stone Weight 0.95 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.95 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
blue-sapphire-rings