Pear Shaped Amethyst Infinity Promise Ring with Diamond

0
Sale price $916 Regular price $1,029
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Two violet pear-shaped amethysts curve into an infinity-inspired promise ring, creating a soft expression of affection, continuity, and shared meaning. The design brings together the graceful shape of pear-cut amethyst with the delicate sparkle of round diamonds, giving the ring a romantic presence without feeling overly ornate. Thoughtful for a promise, anniversary, birthday, or personal milestone, it carries a sweet message of connection in a refined gemstone silhouette.

1/2 CT Pear Amethyst Infinity Promise Ring with Diamond Accents

This infinity promise ring is crafted with 2 pear-shaped amethysts totaling approximately 0.36 carat, each measuring about 3 x 5 mm. The violet gemstones are paired with 9 round brilliant cut diamonds with an approximate total weight of 0.13 carat, creating a balanced mix of color and sparkle. Prong settings hold both the amethysts and diamonds securely, while metal options include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

What Makes This Special

The ring features 2 pear-shaped amethysts in violet color, graded AAA and cut in a brilliant style to enhance their rich purple tone. Their matching pear shapes give the infinity design a graceful flow and help create a soft, romantic focal point across the finger.

The diamond accents include 9 round brilliant cut diamonds with HI color and SI quality grade. Their sizes are thoughtfully varied, with 2 diamonds measuring approximately 0.80 x 0.80 mm, 4 measuring approximately 1.40 x 1.40 mm, and 3 measuring approximately 1.50 x 1.50 mm, adding graduated sparkle to the design.

With an approximate product weight of 1.76 gm, the ring has a delicate feel that suits promise-ring styling, everyday sentiment, and easy pairing with other fine jewelry.

Why Choose This Design

The pear cut brings a graceful teardrop shape to the amethyst, giving the ring a softer and more expressive look than a standard round gemstone style. In this design, the two pear amethysts work beautifully with the infinity motif, creating a sense of balance, movement, and emotional connection.

The prong settings help keep the gemstones visually open, allowing the violet amethyst and diamond accents to catch light from different angles. The combination of colored gemstones and diamonds makes the ring meaningful enough for a promise while still versatile enough to wear as a romantic everyday piece.

Design Meaning

The infinity motif is a symbol of lasting love, continuing devotion, and a bond that moves forward through time. Paired with two pear-shaped amethysts, the design feels especially fitting for two people connected by trust, care, and shared promise. The violet tone of amethyst adds a gentle emotional depth, while the diamond accents bring light to the message, making the ring a thoughtful expression of commitment, affection, and personal celebration.

Authenticity & Craftsmanship

Rosec Jewels crafts this ring with careful attention to gemstone placement, secure prong setting, and refined finishing. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, helping ensure the ring is prepared with care before it reaches the wearer. A Certificate of Authenticity is included with the product, and care guidance is provided to help customers preserve the amethyst color, diamond sparkle, metal finish, and setting structure over time.

Style and Wearability

This amethyst infinity ring has a delicate profile that feels romantic on its own and easy to style with other rings. The pear-shaped gemstones add a graceful point of color across the top, while the round diamonds bring subtle brightness to the design. It can be worn as a promise ring, a sentimental gift, or a personal reminder of a meaningful bond. Ring size options range from US 3.0 to US 13.0, with a ring sizer option available for added confidence before selecting a size.

Product Information
SKU SHP-RINGS032221872
Weight 1.76 gm (Approximate)
AMETHYST INFORMATION
No.of Stones 2 Pieces
Total Weight 0.36 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Color Voilet
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.13 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1.50X1.50 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
amethyst-rings

FAQs About: 1/2 CT Pear Amethyst Infinity Promise Ring with Diamond

What makes this amethyst ring suitable as a promise ring?

The ring combines an infinity-inspired design with two pear-shaped amethysts and diamond accents, making it a meaningful symbol of lasting affection. Its romantic shape and delicate gemstone layout make it well suited for promises, anniversaries, birthdays, and personal milestones.

What gemstones are used in this ring?

This ring features 2 pear-shaped violet amethysts with an approximate total weight of 0.36 carat. Each amethyst measures about 3 x 5 mm, has a brilliant cut, AAA quality grade, and is secured in a prong setting.

Does this infinity ring include diamonds?

Yes. The ring includes 9 round brilliant cut diamonds with an approximate total weight of 0.13 carat. The diamonds have HI color and SI quality grade and are secured in prong settings as accents within the design.

What does the infinity design symbolize?

The infinity design symbolizes lasting love, continuing connection, and a promise that carries forward. Paired with two pear-shaped amethysts, the motif gives the ring a romantic meaning suited for commitment, devotion, and meaningful gifting.

What metal options are available for this amethyst promise ring?

This ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. These options allow the wearer to choose a cool or warm metal tone for the same amethyst and diamond design.

Does this ring come with a Certificate of Authenticity?

Yes. Rosec Jewels includes a Certificate of Authenticity with the product. The ring also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for this amethyst and diamond ring?

Store the ring separately in a soft pouch or jewelry box, avoid harsh chemicals, and clean it gently with a soft cloth. Since the amethysts and diamonds are prong set, protect the ring from hard impact and have the settings checked periodically if worn often.