Nature Inspired Pink Tourmaline and Diamond Engagement Ring

0
Regular price $1,819
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bring a touch of whimsy and charm to your jewelry collection with this Pink Tourmaline and Diamond Engagement Ring. This carefully curated ring is beautifully embellished with a 5 MM round pink tourmaline, securely placed in prong setting that gently rests on a detailed rose flower design. The petals are intricately crafted to give a delicate, natural feel, while the band is adorned with engraved leaves and tiny details that make the design feel lively and organic. Small round diamonds are set to add subtle sparkle and create a playful contrast that complements the floral motif. Available in a range of sizes, this Nature Engagement Ring is made to be worn comfortably every day or saved for special moments. This Flower Engagement Ring is an ideal choice for anyone who loves jewelry that tells a story and reflects personality. Whether it is chosen as a unique engagement ring, a birthday gift, or a meaningful present for someone special, it is sure to make the wearer feel cherished and stylish. The Pink Tourmaline Ring comes in a lovely jewelry box, ready to be gifted or added to your own collection of standout pieces.

Product Information
SKU SHP-RINGS0821187962
Width 6 mm
Height 8 mm
Metal Weight 3.60 gm (Approximate)
Total Stone Weight 0.59 Carat (Approximate)
PINK TOURMALINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Pink
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tourmaline-engagement-rings