Nature Inspired Lab Grown Diamond Eternity Necklace

0
Regular price $1,699
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate natures eternal elegance with this breathtaking Diamond Eternity Necklace - a piece that beautifully captures the delicate rhythm of the natural world. Thoughtfully designed, this Leaf Necklace features a graceful circular frame set with shimmering round cut lab grown diamonds. Within this sparkling open circle, a branch motif extends upward, adorned with a mix of round and marquise cut diamonds in prong setting. Each EF-VS quality diamond symbolizes growth, harmony, and everlasting beauty. This Nature Inspired Necklace exudes timeless sophistication and is perfect for marking lifes special moments. Whether you are dressing up for wedding, adding sparkle to your Christmas ensemble, or stepping into the New Year with renewed elegance, this Diamond Circle Necklace brings effortless charm and meaning to your look. Crafted with care and connected by an 18 inch cable chain, the Lab Grown Diamond Necklace sits beautifully at the collarbone, making it an ideal piece for layering or wearing solo as a statement of refined style. Let this piece reflect what nature teaches us every day - grace, strength, and timeless beauty.

Product Information
SKU SHP-PENDANT082310795
Length 20.5 mm
Width 21.8 mm
Metal Weight 4.40 gm (Approximate)
Total Stone Weight 0.90 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 45 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Marquise-3X6 mm-3 Pcs
Round-0.80X0.80 mm-2 Pcs
Round-0.90X0.90 mm-1 Pcs
Round-1.10X1.10 mm-32 Pcs
Round-1.70X1.70 mm-2 Pcs
Round-1X1 mm-5 Pcs
Color White
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More