Nature Inspired Lab Grown Diamond Engagement Ring

0
Sale price $1,295 Regular price $1,489
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bloom in everlasting love with this Floral Engagement Ring. Crafted with perfection, this Ring features 6mm Round Shape Lab Grown Diamond gemstones set in a flower motif, symbolizing a love that blossoms without compromise. Intricately designed, the Diamond Engagement Ring (Synthetic) captures the essence of blooming flowers, creating a timeless masterpiece. Ef-Vs Quality Diamond marks the commitment to sustainability which is reflected in every facet of this Lab Grown Diamond Ring.

Product Information
SKU SHP-RINGS122310153
Metal Weight 2.80 gm (Approximate)
Center Stone Weight 0.99 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 49 Pieces
Total Weight 1.33 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-42 Pcs
Round-1.50X1.50 mm-6 Pcs
Round-6X6 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More