Natural Solitaire Tanzanite Engagement Ring with Diamond Flower

0
Regular price $1,119
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Vivid Tanzanite with Floral Elegance

This natural tanzanite solitaire engagement ring is created for those who appreciate rare color and distinctive detailing. The center tanzanite displays a captivating blue-violet tone that shifts subtly in different lighting, offering depth and individuality.

Its solitaire focus ensures the gemstone remains the visual centerpiece while refined accents enhance the overall design.

Diamond Flower Accent Design

The diamond flower detail introduces a delicate, nature-inspired element to the classic solitaire style. Carefully arranged diamonds form a floral motif that adds brilliance and contrast around the center stone.

This thoughtful combination balances bold gemstone color with soft, intricate detailing.

Natural Tanzanite Characteristics

Natural tanzanite is valued for its distinctive violet-blue hue and rarity. Its rich coloration makes it an expressive alternative to traditional engagement stones.

With appropriate care and mindful wear, a tanzanite engagement ring can remain a meaningful and eye-catching choice.

High-Level Features

This engagement ring features a natural tanzanite center stone accented by a diamond flower design. The setting emphasizes vibrant color, elegant structure, and a unique floral touch suited for modern proposals.

Product Information
SKU SHP-RINGS082223532
Metal Weight 2.50 gm (Approximate)
Center Stone Weight 0.54 Carat (Approximate)
TANZANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type 4-Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.08 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 4-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stone-shape-swatches

FAQs About: Natural Tanzanite Solitaire Engagement Ring With Diamond Flower

What makes tanzanite unique for engagement rings?
Tanzanite is known for its rare blue-violet color that can appear slightly different depending on lighting conditions.
How does the diamond flower detail enhance the design?
The diamond flower motif adds structured sparkle and a soft floral element, complementing the solitaire center stone.
Is a solitaire setting a timeless choice?
A solitaire setting focuses attention on a single center stone, offering a classic and enduring engagement ring style.
Can this ring be paired with a wedding band?
Depending on the ring’s profile, it may be paired with straight or contoured wedding bands to create a cohesive bridal set.
Does tanzanite require special care?
Tanzanite should be worn and cleaned with care to help preserve its surface and color over time.