Natural Ethiopian Opal October Birthstone Ring with Celtic Knot

0
Regular price $989
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful October Birthstone Ring

This natural Ethiopian opal October birthstone ring blends symbolic design with luminous gemstone character. The opal’s shifting play of color creates a soft yet captivating focal point, making it a distinctive choice for personal milestones or birthday gifting.

Framed by intricate Celtic knot detailing, the design carries a sense of heritage and enduring connection.

Celtic Knot Design and Setting

The Celtic knot motif represents continuity and timeless bonds, adding depth beyond aesthetics. Its interwoven structure enhances the ring’s visual texture while providing a balanced frame for the center stone.

The setting is crafted to hold the opal securely while allowing light to interact with its surface, encouraging its natural play-of-color effect.

Natural Ethiopian Opal Characteristics

Natural Ethiopian opal is admired for its vibrant flashes of color that shift with movement and lighting. Each stone displays its own unique pattern, making every ring visually individual.

As a birthstone for October, opal is often associated with creativity and individuality, adding personal meaning to the design.

High-Level Features

This ring features a natural Ethiopian opal center stone set within a Celtic knot inspired design. The piece highlights symbolic detailing, luminous color variation, and a balanced silhouette suitable for thoughtful gifting or everyday elegance.

Product Information
SKU SHP-RINGS0821223599
Width 2.4 mm
Height 8.2 mm
Metal Weight 2.40 gm (Approximate)
Center Stone Weight 0.50 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Marquise-4X8 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
october-birthstone-jewelry

FAQs About: Natural Ethiopian Opal Celtic Knot Birthstone Ring

What makes Ethiopian opal unique?
Ethiopian opal is known for its vibrant play of color, displaying shifting flashes of multiple hues that change with light and movement.
What does the Celtic knot symbolize in jewelry?
The Celtic knot traditionally represents continuity and interconnectedness, making it meaningful for gifts symbolizing lasting bonds.
Is opal suitable for regular wear?
Opal can be worn regularly with mindful care. Avoiding strong impact and exposure to harsh chemicals helps preserve its surface and appearance.
Is this ring specifically designed as an October birthstone piece?
Yes, opal is recognized as the birthstone for October, making this ring a meaningful choice for October birthdays or commemorative occasions.
Will each opal look exactly the same?
No. Natural opals display individual color patterns and flashes, so each stone has a unique visual character.