Natural Ethiopian Opal and Moissanite Teardrop Jewelry Set

0
Sale price $1,699 Regular price $1,909
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Bring color and high-impact sparkle to bridal styling with this natural Ethiopian opal and moissanite teardrop jewelry set. The coordinated necklace and dangle earrings pair rainbow Ethiopian opals with brilliant white moissanite in pear, round, and marquise shapes, creating a graceful drop composition suited to weddings, receptions, milestone celebrations, and statement gifting. The matching design gives the set a polished, coordinated presence without requiring separate pieces to be styled together.

2.39 Carat Ethiopian Opal and Moissanite Necklace & Earring Set

The complete jewelry set carries an approximate total stone weight of 2.39 carats. Three pear-shaped Ethiopian opals contribute approximately 1.06 carats, including two 3 x 5 mm stones and one 5 x 7 mm centerpiece. Each opal has rainbow color, brilliant faceting, AAA quality, and a prong setting. Twenty-nine white moissanite stones add approximately 1.33 carats in a mix of round and marquise shapes, with brilliant cuts, D-VS1 quality, and prong settings. The set is crafted in 92.5 sterling silver with an approximate metal weight of 5.48 grams.

What Makes This Ethiopian Opal Teardrop Jewelry Set Special

  • Coordinated bridal set: A matching necklace and pair of dangle drop earrings create a complete look for wedding and occasion styling.
  • Pear-shaped Ethiopian opals: Three AAA rainbow opals establish the teardrop theme and introduce shifting color throughout the design.
  • Mixed-cut moissanite: Round and marquise D-VS1 moissanite stones add contrast and bright sparkle around the opals.
  • Prong-set gemstones: Both the opals and moissanites are secured in prong settings that keep the individual stone shapes clearly visible.
  • Adjustable necklace: A lobster clasp allows the necklace length to be adjusted for different necklines.
  • Secure earrings: The coordinating dangle earrings use screw-back closures for a secure fit.
  • Metal: Available in 92.5 sterling silver and selected yellow white or rose gold options in 10K, 14K, and 18K.

Meaning Behind the Opal and Moissanite Teardrop Design

The pear-shaped opals give the set its flowing teardrop character, while the mix of round and marquise moissanite builds brightness around their rainbow color. This balance of color and sparkle makes the design particularly fitting for weddings and milestone celebrations, where the coordinated necklace and earrings can feel both ceremonial and personal. The drop silhouette also creates visual movement, giving the jewelry presence without relying on a single oversized stone.

Ethiopian Opal Jewelry Authenticity & Craftsmanship

Rosec Jewels crafts this opal and moissanite set with attention to gemstone placement, prong security, closure function, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with its jewelry, and each piece goes through stone inspection, setting security review, and finishing inspection before dispatch. For ongoing care, store the set separately, handle the opals gently, and keep the jewelry away from harsh chemicals and abrasive surfaces to help preserve its finish and sparkle.

Styling the Ethiopian Opal and Moissanite Bridal Jewelry Set

The necklace is designed to work across different bridal necklines with its adjustable lobster clasp, while the matching screw-back drop earrings extend the pear-shaped motif around the face. The rainbow opals introduce soft color and the white moissanite adds crisp brilliance, allowing the set to complement wedding attire, reception looks, formal celebrations, and special-occasion outfits. Worn together, the pieces create a coordinated statement; individually, the necklace or earrings can bring the same teardrop sparkle to later occasions.

Product Information
SKU SHP-PENDANT032215222
Metal Weight 5.48 gm (Approximate)
Total Stone Weight 2.39 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 3 Pieces
Total Weight 1.06 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Pear-5X7 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
MOISSANITE INFORMATION
No.of Stones 29 Pieces
Total Weight 1.33 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-10 Pcs
Round-2.50X2.50 mm-4 Pcs
Marquise-2.50X5.00 mm-2 Pcs
Round-2X2 mm-2 Pcs
Marquise-2X4 mm-2 Pcs
Round-3X3 mm-1 Pcs
Color White
Cut Brilliant
Shape Round, Marquise
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
opal-necklaces

FAQs About: Natural Ethiopian Opal and Moissanite Teardrop Jewelry Set

What pieces are included in the Ethiopian opal jewelry set?

The set includes a coordinated Ethiopian opal and moissanite necklace with matching dangle drop earrings. The necklace has an adjustable lobster clasp, while the earrings are finished with secure screw-back closures.

How many Ethiopian opals are used in this teardrop jewelry set?

The design includes three pear-shaped Ethiopian opals with an approximate combined weight of 1.06 carats. Two measure approximately 3 x 5 mm and one measures approximately 5 x 7 mm. The opals are rainbow in color, brilliant cut, AAA quality, and prong set.

What type of moissanite is used with the Ethiopian opal?

The set contains 29 white moissanite stones totaling approximately 1.33 carats. They are brilliant cut in round and marquise shapes, graded D-VS1, and secured in prong settings.

What is the total stone weight of the opal and moissanite set?

The Ethiopian opals and moissanite stones have an approximate combined weight of 2.39 carats, including approximately 1.06 carats of opal and 1.33 carats of moissanite.

Is this Ethiopian opal jewelry set suitable for bridal wear?

Yes. The matching necklace and dangle earrings are designed for bridal styling, with pear-shaped rainbow opals and bright moissanite creating a coordinated look for wedding ceremonies, receptions, and pre-wedding celebrations.

What metal is use for the Ethiopian opal and moissanite jewelry set?

The confirmed set is crafted in 92.5 sterling silver and selected yellow white or rose gold options in 10K, 14K, and 18K with an approximate metal weight of 5.48 grams.

Does this opal and moissanite jewelry set come with authenticity support?

Yes. Rosec Jewels offers a Certificate of Authenticity with its jewelry. Pieces also go through stone inspection, setting security review, and finishing inspection before dispatch. Store the set separately and avoid harsh chemicals or abrasive surfaces when caring for it.