Natural Emerald Flower Engagement Ring with Diamond

0
Sale price $1,537 Regular price $1,689
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Experience the beauty of a blooming flower with this enchanting Flower Engagement Ring, a romantic masterpiece inspired by the elegance of nature and timeless love. At the center of the floral design shines a mesmerizing 5 mm Round Shape Emerald set in Prong Setting, symbolizing harmony, renewal and a love that grows stronger with every passing moment. Leaf inspired patterns gracefully wrap around the band, while sparkling Diamond stones add a soft shimmer that captures attention from every angle. Crafted for the woman who adores beauty with meaning, this Emerald Engagement Ring blends vintage charm with modern sophistication, making it a treasured symbol of devotion, commitment and unforgettable memories. The floral motif represents blossoming romance, while the AAA Quality Emerald center stone reflects loyalty, hope and a deep emotional connection between two hearts. Whether chosen for a proposal, anniversary, promise or a meaningful surprise, this exquisite Emerald Diamond Engagement Ring brings a magical touch to every special occasion. Presented in a signature jewelry box and available in multiple ring sizes for the perfect fit, this Emerald Ring for Women is designed to celebrate eternal love in the most graceful and captivating way.

Product Information
SKU SHP-RINGS0821187974
Width 6 mm
Height 8 mm
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 0.64 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
emerald-engagement-rings