Natural Emerald Eternity Wedding Band with Milgrain Detail

0
Sale price $591 Regular price $649
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Emerald Eternity Wedding Band

The Natural Emerald Eternity Wedding Band with Milgrain Detail presents a refined gemstone band designed to symbolize continuity and lasting connection. The ring features a sequence of emerald gemstones arranged in an eternity style, creating a balanced design that highlights the distinctive green tones of the stones across the band.

Milgrain Inspired Craftsmanship

Milgrain detailing introduces a subtle vintage character to the ring. This decorative technique uses delicate beaded edges along the metal surface, creating texture and definition that frame the gemstones. The fine milgrain pattern enhances the ring’s overall structure while adding a timeless design element.

Natural Emerald Gemstones

Emerald gemstones are admired for their vibrant green color and distinctive appearance. When arranged in an eternity style, the stones create a continuous line of color that wraps around the band. This design emphasizes the beauty of the gemstones while maintaining a balanced and elegant presentation.

A Classic Eternity Band Style

The combination of emerald gemstones and milgrain detailing results in a wedding band that blends classic inspiration with refined craftsmanship. The continuous gemstone design makes the ring a meaningful choice for weddings, anniversaries, or milestone occasions.

Product Information
SKU SHP-RINGS082018939
Width 2.9 mm
Height 1.4 mm
Metal Weight 2.80 gm (Approximate)
Total Stone Weight 1.12 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 30 Pieces
Total Weight 1.12 Carat (Approximate)
Dimension(approx) Round-2X2 mm-18 Pcs
Round-1.50X1.50 mm-12 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Surface-Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
emerald-rings
What is an eternity wedding band?
An eternity wedding band features gemstones arranged around the band to represent continuity and lasting commitment.
What is milgrain detailing in jewelry?
Milgrain detailing is a decorative technique that creates small beaded edges along the metal surface, often used to add texture and vintage style to jewelry.
Why are emeralds used in wedding bands?
Emeralds are valued for their vibrant green color and distinctive appearance, offering a gemstone alternative to traditional diamond wedding bands.
Can an emerald eternity band be worn daily?
Emerald bands can be worn regularly with care. Avoiding strong impact and removing the ring during activities that may expose it to harsh conditions can help protect the gemstones.
How should an emerald ring be cleaned?
Clean an emerald ring using mild soap, warm water, and a soft cloth. Gentle cleaning helps maintain the gemstone’s appearance.