Natural Emerald Butterfly Cartilage Piercing Earring

0
Sale price $390 Regular price $429
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Bring a touch of nature-inspired color to your ear stack with this Natural Emerald Butterfly Earring for Cartilage Piercing. Four green emeralds form the petite butterfly motif, combining round and marquise shapes to give the wings clear definition within a compact 5.2 mm design. Sold singly and designed for upper-ear styling, this emerald cartilage earring is a meaningful choice for personal wear, May birthstone gifting, or marking a moment of change and renewal.

0.10 Carat Natural Emerald Butterfly Cartilage Earring in 10K Yellow Gold

The butterfly is set with four natural emeralds totaling approximately 0.10 carat. Two round emeralds measure about 1.50 x 1.50 mm, while two marquise emeralds measure approximately 1.50 x 3.00 mm. All four stones are green, brilliant cut, AAA quality, and secured in prong settings. The confirmed design is crafted in 10K yellow gold with an approximate metal weight of 0.26 gram and measures about 4 mm long, 5.2 mm wide, and 1.5 mm high. Flat-back post lengths from 4.5 mm to 7.5 mm are offered, along with left- or right-ear selection.

What Makes This Emerald Butterfly Cartilage Earring Special

  • Four natural green emeralds totaling approximately 0.10 carat.
  • Two round and two marquise emeralds create the butterfly shape.
  • AAA quality gemstones with brilliant-cut faceting.
  • Prong settings keep each small emerald clearly defined.
  • Compact butterfly design measuring approximately 4 x 5.2 mm.
  • Crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K .
  • Flat-back post options from 4.5 mm to 7.5 mm.
  • Available for left- or right-ear placement and sold as a single earring.

Meaning Behind the Natural Emerald Butterfly Design

The butterfly motif is often associated with transformation and renewal, giving this small cartilage earring meaning beyond its decorative shape. Using marquise and round emeralds helps define the wings while keeping the profile compact for upper-ear placement. The vivid green gemstones add a natural point of color, making the design especially fitting for May birthstone jewelry, personal milestones, or a thoughtful gift connected with growth and new beginnings.

Natural Emerald Jewelry Authenticity & Craftsmanship

Rosec Jewels crafts its gemstone jewelry with attention to precise stone placement, secure settings, and refined finishing. A Certificate of Authenticity is offered with Rosec Jewels jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to help maintain the gemstones and precious-metal finish.

Styling an Emerald Butterfly Earring for Cartilage Piercing

At approximately 5.2 mm wide, the butterfly adds recognizable detail without overwhelming a curated ear stack. Wear the single emerald cartilage earring as a green focal point or combine it with petite studs, hoops, or other upper-ear jewelry. Multiple flat-back post lengths and left- or right-ear options allow the piece to be selected for your preferred piercing placement and styling direction.

Product Information
SKU SHP-BODYJ052210063
Length 4 mm
Width 5.2 mm
Height 1.5 mm
Metal Weight 0.26 gm (Approximate)
Total Stone Weight 0.10 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 4 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-2 Pcs
Marquise-1.50X3.00 mm-2 Pcs
Color Green
Cut Brilliant
Shape Round, Marquise
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Natural Emerald Butterfly Earring for Cartilage Piercing

How many natural emeralds are in this butterfly cartilage earring?

The butterfly design contains four natural green emeralds totaling approximately 0.10 carat. Two are round and two are marquise shaped, creating the defined butterfly-wing arrangement.

What are the cut, size, and quality of the emeralds?

The earring has two round emeralds measuring approximately 1.50 x 1.50 mm and two marquise emeralds measuring about 1.50 x 3.00 mm. All four stones are brilliant cut, AAA quality, green in color, and secured in prong settings.

What metal is used for this natural emerald cartilage earring?

The confirmed design is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18  and has an approximate metal weight of 0.26 gram.

Does the emerald butterfly earring have a flat back?

Yes. Flat-back post lengths of 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm are offered, allowing the post length to be selected for the intended cartilage piercing.

Is this butterfly cartilage earring sold as a pair?

No. This emerald butterfly cartilage earring is sold singly. Left-ear and right-ear selections are available so the butterfly can be positioned according to your preferred ear styling.

What does the emerald butterfly design symbolize?

Butterfly motifs are commonly associated with transformation and renewal. Combined with natural green emeralds, the design works well as personal milestone jewelry, a May birthstone gift, or a nature-inspired addition to an ear stack.

Does the emerald earring come with authenticity documentation and how should I care for it?

Rosec Jewels offers a Certificate of Authenticity with its jewelry and carries out stone inspection, setting security review, and finishing inspection before dispatch. Clean the earring gently with mild soap, lukewarm water, and a soft cloth, avoid harsh chemicals and strong impact, and store it separately when not worn.