Certified Diamond Starburst Drop Earring for Helix Piercing

0
Regular price $589
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Youll never want to take out the stunning Starburst Drop Earring. Featuring a round diamond on top, while a cluster of round diamonds is studded on a star motif. This celestial earring adds a beautiful sparkle to any look and will make you feel incredible whenever you wear it. For an extra shine, pair with other diamond piercing jewelry. This stunning earpiece is ideal for Helix Piercing, it can also adorn other ear placements like Cartilage or Upper Lobe. Crafted with care and precision to ensure comfort and safety for all-day wear, this diamond drop earring can be the perfect gift to celebrate special moments and milestones.

Product Information
SKU SHP-BODYJ052310066
Metal Weight 0.78 gm (Approximate)
Total Stone Weight 0.33 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 14 Pieces
Total Weight 0.33 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-8 Pcs
Round-1.60X1.60 mm-4 Pcs
Round-2.20X2.20 mm-1 Pcs
Round-2.50X2.50 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More