Natural Diamond Sideways Key Necklace

0
Regular price $1,389
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Natural Diamond Sideways Key Necklace

This necklace features a key shaped pendant placed horizontally along the chain, creating a modern interpretation of a classic symbolic design. The sideways orientation gives the piece a contemporary appearance while maintaining the recognizable form of the key motif.

Diamond accents enhance the pendant with subtle brilliance, allowing the necklace to balance symbolism and refined elegance. Its minimal structure makes it easy to incorporate into everyday jewelry styling.

Sideways Pendant Design

Unlike traditional vertical pendants, a sideways design places the pendant horizontally along the chain. This layout creates a streamlined look that sits naturally against the neckline.

The orientation helps the pendant appear integrated with the chain while maintaining a distinctive and modern visual style.

Key Motif Symbolism

Key shaped jewelry has long been associated with symbolism such as opportunity, knowledge, and new beginnings. The design is often chosen for its meaningful interpretation as well as its elegant shape.

This symbolic motif makes key necklaces a thoughtful option for personal jewelry or meaningful gifts.

Natural Diamond Accents

Natural diamonds are formed through geological processes within the earth and are valued for their brilliance and durability. Their presence in the pendant adds subtle sparkle that complements the overall design.

Diamond accents help highlight the shape of the key while maintaining a refined and balanced appearance.

Product Information
SKU SHP-PENDANT032210031
Length 7.8 mm
Width 18 mm
Height 1.5 mm
Metal Weight 3.20 gm (Approximate)
Total Stone Weight 0.27 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 23 Pieces
Total Weight 0.27 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-10 Pcs
Round-1.20X1.20 mm-13 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-necklaces

FAQs About: Natural Diamond Sideways Key Necklace

What does a key necklace symbolize?
Key necklaces are often associated with symbolism such as opportunity, knowledge, new beginnings, and personal meaning.
What is a sideways pendant necklace?
A sideways pendant necklace features a pendant positioned horizontally along the chain, creating a contemporary and streamlined design.
Why are diamonds used in key necklaces?
Diamonds are often used in key necklaces to add subtle brilliance and highlight the shape of the pendant.
Can a sideways pendant necklace be worn daily?
Sideways pendant necklaces are commonly worn every day because their design sits smoothly along the neckline and pairs easily with other jewelry.
Do key necklaces make good gifts?
Key necklaces are often chosen as gifts because the symbolic meaning can represent milestones, achievements, or meaningful relationships.
How can a key necklace be styled?
A key necklace can be worn alone as a subtle statement piece or layered with other necklaces to create a modern layered jewelry look.