Natural 7.4 Carat Freshwater Pearl Flower Engagement Ring with Diamond

0
Regular price $1,419
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate love in full bloom with this enchanting Flower Engagement Ring, designed to capture the poetry of nature and the beauty of a lifelong bond. At its center rests an 8 mm Freshwater Pearl, glowing softly with natural elegance, symbolizing purity, harmony and a love that blossoms gently but deeply over time. Surrounding the AAA Quality Pearl is a flower motif adorned with sparkling Diamond stones, each petal representing growth, care and the shared journey of two souls coming together. The floral design reflects how love, when nurtured with trust and devotion, continues to bloom in the most beautiful way. HI-SI Quality Diamond stones add a radiant brilliance, symbolizing strength, clarity and the precious moments that make a relationship truly unforgettable. The combination of Pearl and floral artistry creates a graceful harmony between softness and sparkle, tradition and modern elegance. Perfect as an engagement ring or a meaningful promise of forever, this Pearl Diamond Engagement Ring stands as a symbol of commitment and a bond that flourishes with time. Presented in a signature jewelry box and available in various ring sizes, this Freshwater Pearl Engagement Ring is ready to mark a special moment and become a timeless reminder of eternal love in its most graceful form.

Product Information
SKU SHP-RINGS022150332
Width 10.5 mm
Height 11.5 mm
Metal Weight 3.10 gm (Approximate)
Center Stone Weight 7.48 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 7.48 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.30 Carat (Approximate)
Dimension(approx) Round-1.70X1.70 mm-10 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
pearl-engagement-rings