Moissanite Vintage Looking Engagement Ring with Certificate

0
Sale price $1,208 Regular price $1,389
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate your love story with our Vintage Moissanite Engagement Ring that captures the essence of retro beauty and modern brilliance. This breathtaking Round Engagement Ring is a perfect blend of antique charm and contemporary elegance. At its center sparkles a 7 MM round moissanite, held gracefully in prong setting that highlights its exceptional fire and clarity. The vintage-inspired design is elevated with delicate beaded accents and intricately placed smaller moissanites, forming a harmonious Art Deco motif that whispers of romance from another era. Every detail is thoughtfully crafted to evoke a sense of nostalgia, while still appealing to today’s refined tastes. Handcrafted with D-VS1 quality Moissanites, this Antique Engagement Ring is an exquisite choice for those who value both beauty and responsibility. Available in a variety of metal colors and purity options, you can customize this heirloom-worthy piece to suit your personal style. Whether it marks an engagement, anniversary, or simply celebrates a special moment, this Moissanite Art Deco Ring is a symbol of enduring love and timeless elegance. Complete with a certificate of authenticity, it’s a meaningful treasure designed to last a lifetime.

Product Information
SKU SHP-RINGS032012555
Width 5.8 mm
Height 14 mm
Metal Weight 3.80 gm (Approximate)
Center Stone Weight 1.36 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 9 Pieces
Total Weight 1.58 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-8 Pcs
Round-7X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-engagement-rings