Moissanite Cross Dangly Earring for Helix Piercing

0
Sale price $382 Regular price $439
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Add movement and personal meaning to a curated ear with this moissanite cross dangly earring for helix piercing. Eight round white moissanites create approximately 0.28 carat of brilliance, pairing a larger round stone with a dangling cross accented by smaller stones. Crafted in 10K yellow gold with a flat-back post, the single earring brings together bright D-VS1 moissanite sparkle, a symbolic cross motif, and a delicate drop profile suited to helix, cartilage, tragus, conch, or upper-lobe styling.

0.28 Carat Moissanite Cross Dangle Helix Earring

The design is set with eight round brilliant moissanites totaling approximately 0.28 carat. One stone measures about 2.50 x 2.50 mm, while seven smaller stones measure approximately 1.50 x 1.50 mm each. All are white D-VS1 quality moissanites secured in prong settings. The earring measures approximately 12.5 mm in length, 2.2 mm in width, and 2.2 mm in height, with an approximate metal weight of 0.80 gram.

Standout Details of This Moissanite Cross Helix Earring

  • Eight round white moissanites with approximately 0.28 carat total stone weight
  • D-VS1 gemstone quality with brilliant-cut faceting
  • One approximately 2.50 mm round moissanite
  • Seven approximately 1.50 mm round moissanites
  • Prong settings throughout the moissanite design
  • Dangling cross motif for added movement
  • Approximately 12.5 mm long and 2.2 mm wide
  • Approximate metal weight of 0.80 gram
  • Flat-back post lengths from 4.5 mm to 7.5 mm
  • Selectable for the left or right ear
  • Sold as a single earring

The contrast between the fixed round moissanite and suspended cross gives the piece more dimension than a conventional cartilage stud, while the smaller prong-set stones keep the overall look fine and light-catching.

Meaning and Appeal of a Moissanite Cross Dangle Earring

The cross motif can carry faith-centered or deeply personal meaning, while its clean geometric form also works as an expressive element in a modern ear stack. Here, the dangling construction introduces subtle movement so the brilliant-cut moissanites catch light as the earring shifts. The compact proportions keep the symbolic design wearable rather than oversized, making it a thoughtful jewelry gift or a distinctive addition to a curated piercing collection.

D-VS1 Moissanite Helix Earring Craftsmanship & Authenticity

Rosec Jewels crafts the earring with attention to moissanite placement, prong security, the suspended cross detail, flat-back construction, and final finishing. The product is presented as certified jewelry, and Rosec Jewels states that its certified moissanite jewelry is supplied with a Certificate of Authenticity. Each piece is handled with quality review in mind, including stone inspection, setting security review, and finishing inspection before dispatch. Gentle jewelry care and secure storage help maintain the moissanite sparkle and polished gold finish.

Styling a Moissanite Dangle Earring for Helix and Cartilage Piercings

The 12.5 mm drop adds visible movement without the scale of a traditional lobe dangle, making this single cross earring especially suited to layered ear styling. It can be worn in helix, cartilage, tragus, conch, or upper-lobe piercings, and coordinated with simple gold studs or other moissanite jewelry. Flat-back post options range from 4.5 mm to 7.5 mm, allowing the length to be selected according to the intended piercing placement and fit.

Product Information
SKU SHP-RINGS052410075
Metal Weight 4.40 gm (Approximate)
Center Stone Weight 0.68 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 21 Pieces
Total Weight 0.84 Carat (Approximate)
Dimension(approx) Pear-5X7 mm-1 Pcs
Round-1.20X1.20 mm-20 Pcs
Color E-F
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Moissanite Cross Dangly Earring for Helix Piercing

How many moissanite stones are in this cross helix earring?

The earring contains eight round white moissanites with an approximate total weight of 0.28 carat. Seven stones measure about 1.50 x 1.50 mm each, while one larger round moissanite measures approximately 2.50 x 2.50 mm.

What quality and setting are used for the moissanite stones?

The round moissanites are D-VS1 quality with white color and brilliant-cut faceting. All eight stones are secured in prong settings.

What metal is the moissanite cross dangle earring made from?

The earring is crafted in 10K yellow gold. Its approximate metal weight is 0.80 gram, and the complete design measures about 12.5 mm in length and 2.2 mm in width.

Which piercings can this moissanite cross earring be worn in?

The design is intended for helix, cartilage, tragus, conch, and upper-lobe piercings. Its dangling cross creates extra movement compared with a standard cartilage stud.

What flat-back post lengths are available for this helix earring?

Flat-back post lengths are available in 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm options. The earring can also be selected for the left or right ear.

Is the moissanite cross helix earring sold as a pair or individually?

The moissanite cross helix earring is sold singly, making it suitable for an individual cartilage piercing or for mixing with other earrings in a curated ear stack.

Does this moissanite helix earring come with authenticity support and how should I care for it?

Rosec Jewels provides authenticity support for its certified moissanite jewelry, including a Certificate of Authenticity. To care for the earring, keep it away from harsh chemicals and abrasive surfaces, clean the gold and moissanite gently, store it securely when not worn, and periodically check the prong settings and flat-back fitting.