Modern Flower Pendant with Round Aquamarine and Diamond

0
Sale price $506 Regular price $569
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Dive into the captivating allure of this mesmerizing contemporary flower pendant. Meticulously crafted to captivate your attention, this pendant features a stunning floral motif adorned with round Diamond and Aquamarine gemstones. The perfect fusion of these gems creates a timeless charm that is bound to turn heads wherever you go. Suspended by a radiant bale, this necklace pendant embodies glamorous allure, making it an excellent choice for those with a discerning sense of fashion. Embrace the irresistible elegance and allure of this exquisite piece, destined to elevate any ensemble with a touch of glamour and sophistication.

Product Information
SKU SHP-PENDANT032214540
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 1.06 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
aquamarine-necklaces