Marquise Diamond Leaf Cluster Helix Earring

0
Sale price $512 Regular price $589
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Beautiful and delicate, this Diamond Leaf Cluster Earring is embellished with sparkling marquise shape diamonds secured by prong setting, assembled in a leaf motif.

  • This Diamond Helix Earring is a stunning piece of jewelry, as you can probably turn any dull outfit into a bright and nicer one with the vibe it carries.
  • You can style this Marquise Diamond Earring on your helix, cartilage, or upper lobe piercing. The Flat back closure will keep it secured in place.
  • Make your anniversary day even more special by presenting this Diamond Cluster Earring to your lady love, she will definitely love it.
Product Information
SKU SHP-BODYJ052310068
Length 7.8 mm
Width 6.2 mm
Height 2 mm
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.35 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-5 Pcs
Marquise-2X4 mm-1 Pcs
Color HI
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade SI
View More