Marquise Diamond Floral Upper Lobe Earring

0
Sale price $434 Regular price $499
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

So charming, the Diamond Floral Earring shines like a star, a perfect piece to showcase natures beauty. This earring is embellished with Marquise Shape Diamonds, all set in prong setting. Its distinctive flower shaped design adds a touch of floral charm to your piercing collection, setting you apart from the ordinary. This marquise diamond earring can be worn in various ways, including Cartilage, Helix, and Upper lobe, offering you the freedom to express your style effortlessly. A flat back closure ensures comfort and security, making it ideal for extended wear without causing irritation. This diamond helix earring is a perfect and unforgettable gift to surprise your loved ones. With its everlasting beauty and outstanding quality, this Flower Cartilage Earring is ideal for any event. Its lightweight design and secure fit make it suitable for both daily wear and special occasions. Shimmering HI-SI quality real diamond stones provide a luxurious shine that instantly elevates your look. The floral motif adds a romantic touch, while the classic stud style introduces a fashionable element.

Product Information
SKU SHP-BODYJ082410056
Metal Weight 0.40 gm (Approximate)
Total Stone Weight 0.50 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-5 Pcs
Color HI
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade SI
View More