Marquise Cut Diamond Lotus Flower Earring for Cartilage Piercing

0
Regular price $509
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Lotus-Inspired Elegance for Cartilage Piercing

This marquise cut diamond lotus flower earring is designed specifically for cartilage piercing placement. The floral silhouette brings soft symmetry to the ear while maintaining a refined and compact profile suitable for curated ear styling.

The marquise-shaped diamonds form petal-like points, creating a balanced lotus motif that appears delicate yet defined.

Structured Setting with Artistic Detail

Each marquise diamond is positioned to enhance the layered petal effect while maintaining structural integrity. The setting supports secure placement within cartilage piercings, offering stability without overwhelming the ear.

The floral layout is intended to sit comfortably along the natural contour of the cartilage, adding dimension to helix or upper ear placements.

Diamond Durability for Daily Wear

Diamonds are valued for their hardness and resistance to surface wear, making them appropriate for everyday jewelry. Their natural brilliance complements the elongated marquise cut, enhancing the petal-inspired design.

With proper care and periodic inspection, the setting maintains both its decorative detail and long-term stability.

High-Level Features

This cartilage earring features marquise cut diamonds arranged in a lotus flower pattern, crafted for secure wear and sculpted elegance. The design blends symbolic floral artistry with precision placement for curated ear styling.

Product Information
SKU SHP-BODYJ052310095
Length 5.8 mm
Width 7.6 mm
Height 1.8 mm
Metal Weight 0.50 gm (Approximate)
Total Stone Weight 0.31 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 4 Pieces
Total Weight 0.31 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-3 Pcs
Round-1.20X1.20 mm-1 Pcs
Color HI
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Marquise Cut Diamond Lotus Flower Earring for Cartilage Piercing

Is this earring suitable for helix or upper cartilage piercings?
The compact lotus design is intended for cartilage placements such as helix or upper ear piercings, depending on individual anatomy and piercing location.
What makes marquise cut diamonds ideal for a lotus design?
The elongated, pointed shape of marquise cut diamonds naturally resembles petals, allowing them to create a defined floral pattern with symmetry.
Is this sold as a single cartilage earring?
Cartilage earrings are typically designed for individual placement. Please refer to the product detail table for confirmation of what is included.
Can this earring be worn daily?
Diamonds are durable and suitable for everyday wear. Regular cleaning and occasional inspection help maintain both comfort and security in cartilage jewelry.
Does the lotus design sit flat against the ear?
The floral arrangement is structured to align with the ear’s contour, offering a balanced appearance while maintaining defined petal detailing.