Marquise and Pear Cut Moissanite Half Eternity Band

0
Regular price $1,189
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Graceful Curves in a Sculpted Band

This marquise and pear cut moissanite half eternity band blends two elongated stone shapes to create a fluid, sculpted look across the top of the ring. The alternating silhouettes introduce movement while maintaining a balanced and refined profile.

Designed for those who appreciate distinctive detailing, this band offers visual interest without overwhelming the hand.

Half Eternity Structure with Defined Shape Play

The half eternity setting places marquise and pear cut moissanite stones along the upper portion of the band, allowing light to interact with each angled facet. The pointed and rounded ends of the stones create a rhythmic pattern that feels both elegant and contemporary.

This layout also allows the underside of the band to remain smooth, supporting comfort in daily wear and ease of stacking with other rings.

Moissanite Brilliance

Moissanite is chosen for its crisp sparkle and noticeable light return, complementing the elongated geometry of marquise and pear cuts. The combination enhances both brilliance and structure in this design.

Moissanite is created without traditional mining, and its environmental impact varies by production and energy source. Its durability and brightness make it suitable for thoughtfully worn everyday jewelry.

High-Level Features

This band features marquise and pear cut moissanite stones arranged in a half eternity setting. The design emphasizes shape contrast, light performance, and a refined silhouette ideal for stacking or wearing alone.

Product Information
SKU SHP-RINGS042210051
Width 5 mm
Height 2.2 mm
Metal Weight 2.89 gm (Approximate)
Total Stone Weight 1.28 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 14 Pieces
Total Weight 1.28 Carat (Approximate)
Dimension(approx) Pear-3X4 mm-4 Pcs
Marquise-2X4 mm-10 Pcs
Color White
Cut Brilliant
Shape Pear, Marquise
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
eternity-rings

FAQs About: Marquise and Pear Cut Moissanite Half Eternity Band

What is the benefit of combining marquise and pear cuts in one band?
The two elongated shapes create contrast and flow, forming a patterned arrangement that adds dimension and visual movement to the band.
Is a half eternity band comfortable for daily wear?
Because the stones are set along the upper half of the ring, the underside remains smooth, which can enhance comfort during regular wear.
Can this band be paired with an engagement ring?
The sculpted shape and half eternity layout allow it to complement various engagement ring styles, especially those with elongated or curved profiles.
Does the alternating pattern affect the ring’s symmetry?
The alternating marquise and pear shapes are arranged in a balanced sequence, preserving overall symmetry while introducing a dynamic design element.
How should moissanite in this band be maintained?
Gentle cleaning and periodic inspection of the setting help maintain the brilliance of the moissanite and ensure the stones remain securely positioned.