Lotus Basket Set Lab Grown Emerald Knot Engagement Ring

0
Regular price $1,159
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Lab Grown Emerald Knot Engagement Ring

This engagement ring features a lab grown emerald center stone supported by a decorative knot-inspired band and lotus basket setting. The structure of the ring combines symbolic design elements with a vibrant green gemstone that becomes the visual focal point of the piece.

The emerald center stone introduces a rich green color that contrasts elegantly with the surrounding metalwork, creating a balanced composition suitable for distinctive engagement jewelry.

Lotus Basket Setting Design

The lotus basket setting elevates the center gemstone while providing structural support beneath the stone. This design allows the gemstone to remain prominent while maintaining stability within the ring’s framework.

Basket settings are often chosen in engagement rings because they secure the gemstone while allowing light to reach it from multiple angles, enhancing the visual presence of the center stone.

Knot-Inspired Band Details

The knot motif incorporated into the band introduces a symbolic element into the design. Knot patterns in jewelry are commonly associated with connection and continuity, making them a meaningful choice for engagement rings.

This decorative structure also adds texture and visual interest to the band while complementing the gemstone setting above.

Lab Grown Emerald Center Stone

Emerald gemstones are recognized for their vivid green color and distinctive appearance in fine jewelry. In this ring, the emerald center stone provides a strong focal point that contrasts with the surrounding metal and design elements.

Lab grown emeralds are created without traditional mining. Environmental impact can vary depending on the production methods and energy sources used during manufacturing.

Product Information
SKU SHP-RINGS0721120533
Width 6 mm
Height 9 mm
Weight 2.96 gm (Approximate)
Center Stone Weight 2.18 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 2.18 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
lab-created-emerald-rings

FAQs About: Lotus Basket Set Lab Grown Emerald Knot Engagement Ring

What is a lotus basket setting in a ring?
A lotus basket setting supports the center gemstone with a structured metal base beneath the stone, helping elevate and secure the gemstone within the ring design.
What does a knot design represent in jewelry?
Knot motifs in jewelry are often used as symbolic design elements representing connection, unity, and continuity.
What is a lab grown emerald?
A lab grown emerald is produced in a controlled environment rather than mined from the earth while maintaining the same chemical composition as natural emerald.
Why choose an emerald engagement ring?
Emerald engagement rings are chosen for their distinctive green color and their ability to create a bold alternative to traditional diamond center stones.
How does a basket setting benefit a gemstone?
Basket settings hold the gemstone securely while allowing light to reach it from multiple angles, helping the stone remain visually prominent.
Are colored gemstone engagement rings popular?
Yes. Colored gemstone engagement rings have become popular for couples who want a distinctive gemstone instead of a traditional diamond center stone.