Lab Grown Emerald Diamond Flower Engagement Ring with Certificate

0
Regular price $1,409
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

An enchanting piece of jewelry, this Flower Engagement Ring is designed to celebrate love with nature-inspired beauty. At the center of this Nature Inspired Engagement Ring sits a stunning 4 MM Round Shape Lab Created Emerald set in a mesmerizing rose flower motif that symbolizes growth, beauty and new beginnings. The rich green hue of the Lab Emerald adds a vibrant and elegant touch, making the centerpiece stand out beautifully. Surrounding the band are dainty lab grown diamond stones, carefully studded over with intricate leaf detailing, giving this Lab Grown Emerald Ring a delicate and graceful look. The combination of the sparkling lab created diamond and the vivid green AAAA Quality Lab Emerald creates a perfect balance of color and brilliance. Every element of this Lab Emerald Engagement Ring is thoughtfully designed to reflect both timeless elegance and the beauty of nature. The Lab Grown Emerald offers ethical and sustainable brilliance and also serves as a unique symbol of everlasting love. This enchanting Emerald and Diamond Engagement Ring is sure to become a treasured piece in her jewelry collection. It is perfect for someone who loves elegant, meaningful designs, destined to be cherished for a lifetime.

Product Information
SKU SHP-RINGS082227737
Width 6 mm
Height 8 mm
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 0.41 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.27 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

Product Parent Collection Handle
lab-created-emerald-rings
Is the emerald lab grown?
Yes, this ring features a lab grown emerald center stone.
Does the ring come with a certificate?
Yes, this engagement ring includes certification for the featured gemstone.
What style is the setting?
The setting is designed in a flower-inspired style, framing the emerald with petal-like detailing.
Is this ring suitable for everyday wear?
With proper care and regular inspection of the setting, this ring can be worn regularly. Removing it during strenuous activities can help protect the gemstone and metal.
Can it be paired with a wedding band?
The floral design allows it to be paired with straight or contoured wedding bands, depending on your preferred style.