Lab Grown Emerald Designer Flower Engagement Ring

0
Sale price $895 Regular price $1,029
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Mesmerize onlookers with the Floral Engagement Ring, a stunning embodiment of elegance and sophistication. An 8 mm Round Shape Emerald (lab grown) takes center stage, surrounded by a delicately handcrafted floral motif adorned with sparkling Lab Grown Diamond gemstones that add a touch of glamour. Meticulously crafted by Rosec Jewels, known for their commitment to ethically sourced gems, this Aaaa quality Emerald Engagement Ring is a symbol of love, making it the perfect choice for a memorable and conscious declaration of eternal commitment. This Emerald and Diamond Ring brings the perfect mix of elegance and boldness, ensuring all eyes are on you. Its eye-catching design makes it an ideal accessory for adding a touch of retro luxury to your ensemble.

Product Information
SKU SHP-RINGS122310202
Metal Weight 1.92 gm (Approximate)
Center Stone Weight 2.18 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 2.18 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-2.10X2.10 mm-8 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More