Lab Grown Diamond Swirl Earrings With Screw Back

0
Regular price $1,319
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Modern Swirl Earrings with Refined Appeal

The Lab Grown Diamond Swirl Earrings with Screw Back are designed for those who appreciate contemporary shapes with a refined finish. The flowing swirl form adds movement and visual interest while maintaining a balanced and elegant look.

These earrings offer a modern alternative to traditional studs, making them suitable for both daily wear and special occasions.

Swirl Design with Structured Detailing

The swirl motif is crafted to create a sense of motion, guiding the eye through the design while highlighting the placement of diamonds. This structure enhances visual depth without appearing overly complex.

The setting supports the diamonds securely while allowing light interaction to maintain a refined sparkle.

Lab Grown Diamonds with Contemporary Origin

Lab grown diamonds offer the same physical and visual properties as natural diamonds, making them suitable for regular wear. They are created without traditional mining, and their impact varies by production and energy source.

Their clarity and consistent appearance make them a practical choice for modern jewelry designs.

High-Level Features Buyers Appreciate

The screw back closure provides added security, helping keep the earrings in place throughout the day. This feature supports both comfort and confidence during wear.

The combination of a contemporary swirl pattern and secure fastening makes these earrings suitable for versatile styling across different occasions.

Product Information
SKU SHP-EARRINGS122310134
Weight 2.40 gm (Approximate)
Center Stone Weight 1.16 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 88 Pieces
Total Weight 1.16 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-78 Pcs
Round-1X1 mm-8 Pcs
Round-4X4 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-created-diamond-earrings

FAQs About: Lab Grown Diamond Swirl Earrings with Screw Back

What are swirl earrings?
Swirl earrings feature a curved, flowing design that creates a sense of movement and visual interest.
Are lab grown diamonds real diamonds?
Yes, lab grown diamonds have the same physical and visual properties as natural diamonds but are created in controlled environments.
Is the screw back secure for daily wear?
Yes, the screw back mechanism helps keep the earrings securely in place, reducing the chance of them loosening.
Can these earrings be worn every day?
Yes, their durable materials and secure design make them suitable for everyday wear with proper care.
Do swirl designs suit different styles?
Yes, the flowing design complements both minimal and statement looks, making them versatile for various occasions.
Who are these earrings ideal for?
They are ideal for individuals who prefer modern designs with secure closures and a refined overall appearance.