Lab Grown Diamond Spider Stud Earrings with Screw Back

0
Sale price $765 Regular price $879
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Distinctive Design with Contemporary Edge

The Lab Grown Diamond Spider Stud Earrings are crafted for those who prefer jewelry with personality. The spider motif offers a bold yet refined aesthetic, making these studs suitable for expressive styling while remaining elegant in scale. Designed for women who appreciate unique details, they balance statement appeal with wearable proportions.

Structured Setting with Secure Screw Back

Each diamond is positioned to define the spider silhouette while maintaining symmetry and balance. The screw back closure is designed to provide a secure fit, helping keep the earrings comfortably in place throughout the day. This combination of detailed craftsmanship and functional backing makes them suitable for regular wear.

Lab Grown Diamond Value

These earrings feature lab grown diamonds created without traditional mining. Lab grown diamonds share the same physical and optical characteristics as natural diamonds. Environmental impact varies by production and energy source. Verified details regarding carat weight, dimensions, and metal options are available in the product specification tables above.

High-Level Features

  • Spider-inspired stud design with diamond detailing.
  • Lab grown diamonds with natural diamond properties.
  • Screw back closure for added security.
  • Crafted in available precious metal options as listed above.
Product Information
SKU SHP-EARRINGS082310747
Length 7 mm
Width 9.6 mm
Metal Weight 1.50 gm (Approximate)
Total Stone Weight 0.98 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.98 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Round-1.50X1.50 mm-4 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

Product Parent Collection Handle
lab-created-diamond-earrings

FAQs About: Lab Grown Diamond Spider Stud Earrings With Screw Back

Are these diamonds real?
Yes, these earrings feature lab grown diamonds. They have the same physical and visual properties as natural diamonds.
How secure is the screw back closure?
The screw back mechanism is designed to provide a firm and reliable fit, helping keep the earrings securely in place during daily wear.
Can these earrings be worn daily?
Lab grown diamonds are durable and suitable for everyday use. Regular cleaning and careful handling help maintain their appearance over time.
What metal options are available?
Available metal types and finishes are listed in the product detail tables above.
Where can I find carat weight and size details?
All confirmed measurements and carat information are provided in the product specification tables above.