Lab Grown Diamond Mens Wedding Band Ring

0
Sale price $1,791 Regular price $2,059
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Discover a distinctive expression of timeless style with this Diamond Braided Band for Men, thoughtfully designed for those who appreciate classic elegance with a contemporary edge. This striking ring features five round shape lab grown diamonds set in channel setting at the center. Each diamond is selected in EF-VS quality, ensuring exceptional clarity and radiant sparkle while reflecting an ethical and responsible choice. Enhancing the visual appeal, the Wide Wedding Band is detailed with an intricately braided and twisted rope design along the sides, adding texture and character to the overall composition. The contrast between the created diamond center and the sculpted band creates a bold yet timeless look. Expertly crafted with attention to detail, this Lab Grown Diamond Wedding Band for Men offers durability, comfort, and lasting beauty, making it well suited for everyday wear and lifelong significance. Designed as a men’s wedding band, it symbolizes strength, unity, and commitment, while the braided motif represents intertwined journeys and enduring bonds. Its versatile design allows it to complement a wide range of personal styles, ensuring it remains relevant for years to come. Presented in an elegant jewelry box, this Manly Band is ideal for weddings, anniversaries, or meaningful milestones.

Product Information
SKU SHP-RINGS092022542
Width 1.6 mm
Height 4.8 mm
Metal Weight 7.20 gm (Approximate)
Total Stone Weight 0.30 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.30 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-5 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Channel Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
moissanite-rings