Lab Grown Diamond Designer Eternity Necklace

0
Regular price $1,369
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Continuous Expression of Brilliance

The Lab Grown Diamond Designer Eternity Necklace is crafted for those who appreciate uninterrupted sparkle in a refined silhouette. Designed to sit elegantly along the neckline, the eternity layout creates a seamless flow of light from every angle.

Its balanced structure makes it suitable for milestone gifting, anniversary moments, or as a signature piece for elevated daily wear.

Designer Eternity Setting

The eternity-style arrangement features diamonds placed in a continuous sequence, creating uniform brilliance across the visible surface. This structured alignment enhances symmetry and ensures a cohesive, polished appearance.

The setting is engineered to support secure stone placement while maintaining fluid visual movement across the necklace line. For precise construction details, including setting type and measurements, refer to the product specification tables provided on this page.

Lab Grown Diamond Value

Lab grown diamonds offer the same physical and optical characteristics as mined diamonds. They are created without traditional mining, though impact varies by production and energy source.

Known for their clarity and brilliance, lab grown diamonds are well suited for fine jewelry intended for regular wear. Exact stone grades, total carat weight (if applicable), and quality specifications are listed in the product detail tables above.

High-Level Features

  • Continuous eternity-style diamond arrangement.
  • Refined designer structure for balanced brilliance.
  • Lab grown diamonds with verified specifications.
  • Metal options and technical details provided in the product tables.
Product Information
SKU SHP-PENDANT022510057
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 0.49 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 70 Pieces
Total Weight 0.49 Carat (Approximate)
Dimension(approx) Round-1.15X1.15 mm-70 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs about: Lab Grown Diamond Designer Eternity Necklace

What does an eternity necklace design mean?
An eternity necklace features diamonds arranged in a continuous sequence, symbolizing continuity and creating a seamless line of brilliance across the neckline.
Are lab grown diamonds real diamonds?
Lab grown diamonds have the same physical, chemical, and optical properties as mined diamonds. They are produced in controlled environments rather than extracted from the earth.
Is this necklace suitable for everyday wear?
Diamond jewelry is commonly chosen for regular wear due to its durability. Suitability also depends on individual lifestyle and proper care.
How can I confirm the total carat weight and metal options?
All verified specifications, including total carat weight (if applicable), diamond details, chain length, and available metal options, are listed in the product detail tables on this page.
Is this necklace appropriate as a gift?
Eternity-style diamond necklaces are often selected for anniversaries, milestones, and meaningful occasions due to their symbolic and timeless design.