Lab Created 2 Carat Diamond Celtic Knot Engagement Ring

0
Sale price $1,304 Regular price $1,499
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Lab Created Diamond Celtic Knot Engagement Ring

This engagement ring is designed for those who value symbolism as much as beauty. The Celtic knot motif represents continuity and connection, making it a meaningful choice for a lasting commitment.

Created with a lab grown diamond as the focal point, the ring balances visual presence with refined elegance, suited for buyers seeking tradition with a modern approach.

Celtic Knot Design & Setting

The Celtic knot design is integrated into the ring structure to create a continuous, flowing form. This approach enhances visual depth while maintaining a secure and balanced setting.

The setting is designed to support the center stone without excessive height, contributing to both stability and everyday practicality.

Lab Created Diamond Characteristics

Lab created diamonds are selected for their durability and suitability for daily wear in engagement jewelry. These diamonds are created without traditional mining, though impact varies by production and energy source.

The stone placement emphasizes light performance while preserving the integrity of the symbolic knot design.

High-Level Features

  • Celtic knot inspired design with symbolic meaning
  • Lab created diamond suitable for everyday wear
  • Balanced setting focused on comfort and stability
  • Refined profile designed for long-term use
Product Information
SKU SHP-RINGS052410230
Width 5.5 mm
Height 8 mm
Weight 2.09 gm (Approximate)
Center Stone Weight 2.04 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 2.04 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-grown-diamond-engagement-rings

FAQs About: Lab Created Diamond Celtic Knot Engagement Ring

What does the Celtic knot design represent?
The Celtic knot traditionally represents continuity, unity, and enduring connection.
Is this ring suitable for everyday wear?
The design and stone choice make it appropriate for regular wear with proper care.
How does a lab created diamond compare for durability?
Lab created diamonds have the same hardness and durability characteristics as mined diamonds.
Does the design sit high on the finger?
The setting is designed to remain balanced without unnecessary height.
How should this ring be maintained?
Clean gently with a soft cloth and mild solution; avoid harsh chemicals and heavy impact.