IGI Certified Lab Grown Pink White Diamond Flower Engagement Ring

0
Sale price $1,356 Regular price $1,559
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

If you are on the hunt for a Flower Engagement Ring that beautifully narrates your love story, then this Pink Diamond masterpiece, certified by IGI, is definitely the one. The star of this Nature Inspired Engagement Ring is a stunning 6.50 MM round cut lab grown pink diamond, securely set in prong setting. On either side of the VS1 quality pink diamond, you will find two flowers made with marquise cut lab grown diamonds (EF-VS quality). Meticulously designed to represent love and commitment, the flower motif adds a romantic flair, making this Lab Grown Pink Diamond Ring a heartfelt symbol of your everlasting promise. This Pink White Diamond Ring is not just a token of love and passion, it radiates beauty and sophistication. Crafted with sustainable Lab Grown Gemstones, it not only looks amazing but is also eco-friendly. Begin your forever with a piece that is both stunning and gentle on the planet! Its classic yet contemporary design makes it perfect for daily wear or special events. Ideal for engagements, anniversaries, or a memorable romantic gesture, this Pink Flower Ring comes beautifully packaged in an elegant jewelry box, ready to be gifted and treasured.

Product Information
SKU SHP-RINGS012610088
Metal Weight 2.65 gm (Approximate)
Center Stone Weight 1.00 Carat (Approximate)
LAB GROWN PINK DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 1.00 Carat (Approximate)
Dimension(approx) Round-6.50X6.50 mm-1 Pcs
Color Fancy Pink
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS1
LAB GROWN DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-8 Pcs
Color E-F
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade VS
View More