IGI Certified 2 Carat Lab Grown Diamond Radiant Cut Engagement Ring with Celtic Knot

0
Sale price $1,409 Regular price $1,619
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Searching for the ideal present that will bring joy to her face? This Lab Created Diamond Engagement Ring is the one you are looking for. The Solitaire Ring features an IGI Certified 2 Carat Radiant Cut Laboratory Made Diamond (E Color VS1 Clarity) which is set securely in a Prong Setting and has tiny round diamonds also set in bezels as surprise ones. The uniqueness of this Radiant Engagement Ring lies in the amazing Celtic motif done on both sides of the diamond symbolizing endlessness, strength, and everlasting bonds. This Celtic Knot Ring is filled with deep emotions and romantic promises. It celebrates the joining of these two powerful symbols. Built to last, this 2 Carat Engagement Ring signifies love and is beautifully made to honor romantic relationships. It becomes a symbol of the love you share and the bond you cherish. It is a meaningful way to express your feelings without saying a word. Whether you are celebrating a birthday, an anniversary, or just want to find a special gift for someone, this Celtic Design Engagement Ring carries beautiful meanings with a unique diamond cut and the Celtic knot for eternity and strong bonds. It is a timeless treasure that captures the essence of your lasting devotion. Slip it on, and let the love shine louder than words.

Product Information
SKU SHP-RINGS072610011
Width 4.5 mm
Height 8 mm
Metal Weight 2.40 gm (Approximate)
Total Stone Weight 2.03 Carat (Approximate)
LAB GROWN DIAMOND(IGI) INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Radiant Cut-8.50X5.50 mm-1 Pcs
Color E
Cut Brilliant
Shape Radiant Cut
Setting Type Prong-Setting
Quality Grade VS1
LAB GROWN DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.03 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-2 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More