Heart Shape Created Ruby and Diamond Dangle Pendant

0
Regular price $1,339
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Design with Subtle Movement

This heart-shaped pendant is designed for those who value meaningful forms combined with refined structure. The heart motif creates a recognizable focal point, while the dangle element introduces gentle movement.

Its composition offers a balanced presence, making it suitable for both everyday styling and occasional wear.

Dangle Setting with Diamond Accents

The pendant features a suspended design that allows the center element to move naturally. Diamond accents are incorporated to enhance light reflection, complementing the central shape without overwhelming it.

This arrangement creates a structured yet fluid appearance, combining stability with visual motion.

Created Ruby with Defined Color

The created ruby provides a consistent and vibrant tone, adding depth to the overall design. It is created without traditional mining, with impact varying by production and energy source.

When handled with care, it remains suitable for regular wear in pendant designs.

Designed for Versatile Styling

This pendant is suited for those seeking a piece that transitions easily between different settings. Its balanced proportions allow it to pair well with both minimal and layered jewelry styles.

With its combination of symbolic form and subtle movement, it offers a reliable option for long-term use.

Product Information
SKU SHP-PENDANT032214780
Weight 2.64 gm (Approximate)
Center Stone Weight 0.45 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-1 Pcs
Color Red
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 17 Pieces
Total Weight 0.31 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-10 Pcs
Round-1X1 mm-4 Pcs
Round-2.40X2.40 mm-1 Pcs
Round-2X2 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-ruby-necklace

FAQs About: Heart Shape Created Ruby and Diamond Dangle Pendant

What does a heart-shaped pendant symbolize?
A heart-shaped pendant is commonly associated with affection and personal significance, making it a meaningful jewelry choice.
Is this pendant suitable for everyday wear?
The design is suitable for regular wear, though proper care helps maintain its appearance over time.
What is the benefit of a dangle pendant design?
A dangle design introduces subtle movement, adding dimension and visual interest to the piece.
Do diamond accents enhance the look?
Diamond accents add brightness and help balance the overall design by enhancing light reflection.
Will the ruby maintain its color over time?
Created rubies are designed to retain their color, and proper care helps preserve their appearance.
How should I care for this pendant?
Clean gently with a soft cloth, avoid harsh chemicals, and store separately to maintain its finish and clarity.