Heart Shape Blue Sapphire Solitaire Wedding Ring Set with Diamond

0
Sale price $1,473 Regular price $1,619
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Blue Sapphire Bridal Ring Set is a perfect blend of the engagement and wedding rings, creating a stylish piece that is great for any occasion. The Heart Shape Ring stands as the ultimate love symbol, leaving a remarkable impression. This Marriage Ring Set showcases a stunning mix of AAA Quality Blue Sapphire and HI-SI Diamond, capturing the essence of pure passion. It features a 5 MM Heart Shape Blue Sapphire set in a Claw Setting as a solitaire, which symbolizes love and passion, and is ideal for September born ladies. The accompanying curved enhancer band, adorned with delicate round cut Diamond Stones, nestles seamlessly against the engagement ring, creating a contemporary look. Perfect for weddings, vow renewals, or as a promise ring set, this duo is crafted for those who appreciate a blend of tradition and modern style. Make her yours forever with this stunning Engagement and Wedding Ring Set, which boasts genuine Sapphire and Diamonds, radiating brilliance and fire. This exquisite jewelry piece radiates elegance and beauty. Its design includes a delicate heart motif with intricate craftsmanship, making it a timeless and enchanting choice for any event. Whether worn as a love token or to elevate an outfits sophistication, this Heart Wedding Ring Set is guaranteed to leave a lasting impression.

Product Information
SKU SHP-RINGS082212923
Metal Weight 2.72 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Heart-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.37 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-14 Pcs
Round-1.20X1.20 mm-9 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-2.40X2.40 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
blue-sapphire-rings