Genuine Emerald Clover Stud Earrings for Women

0
Regular price $509
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bring a fresh and meaningful charm to your jewelry collection with Clover Flower Stud Earrings that beautifully blend symbolism with style. The design features a circular arrangement of round shaped emerald gemstones, forming an eternity pattern that represents continuity, wholeness, and everlasting elegance. At the center of the design sits a finely crafted metal clover motif, adding a unique focal point that instantly stands out. The clover flower symbolizes luck, hope, and positivity, making these Emerald Stud Earrings feel more personal and thoughtful. Each emerald is AAA quality and securely held in prong setting, allowing maximum light to pass through for that lively sparkle. Designed with screw-back closures, these Eternity Earrings offer a snug and secure fit, so you can wear them comfortably throughout the day without worry. As emerald is the May birthstone, these Emerald Clover Earrings also make a meaningful gift option. Presented in a jewelry box, they Are perfect for gifting or keeping as a special addition to your everyday style.

Product Information
SKU SHP-EARRINGS042157283
Metal Weight 2.50 gm (Approximate)
Total Stone Weight 0.50 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 28 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-28 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
emerald-earrings