Genuine Black Opal and Moissanite Heart Drop Necklace

0
Regular price $1,349
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Heart Shape With Vivid Depth

The Genuine Black Opal and Moissanite Heart Drop Necklace is designed for those who appreciate expressive color and symbolic detail. The heart-shaped silhouette introduces a romantic element, while the black opal center displays shifting flashes of color that change with movement and light.

This combination creates a pendant that feels both personal and visually dynamic.

Moissanite Accent Brilliance

Moissanite accents enhance the design by adding focused sparkle around or above the opal center. Their brightness contrasts with the darker base tone of the black opal, helping the pendant stand out while maintaining balance.

The drop style allows the pendant to rest naturally along the neckline, adding subtle movement.

Black Opal Characteristics

Black opal is valued for its dark body tone and vibrant play-of-color. Each stone can display unique patterns, making every necklace slightly distinctive in appearance.

Due to its natural structure, black opal benefits from mindful wear and proper storage to preserve its surface and color display over time.

High-Level Features

This necklace features a heart-shaped black opal paired with moissanite accents in a drop-style pendant. The design combines symbolic form with vivid color contrast, making it suitable for meaningful gifting or personal statement wear.

Product Information
SKU SHP-PENDANT032215685
Metal Weight 3.67 gm (Approximate)
Total Stone Weight 1.04 Carat (Approximate)
BLACK OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
MOISSANITE INFORMATION
No.of Stones 23 Pieces
Total Weight 0.24 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-22 Pcs
Round-1X1 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
heart-necklaces

FAQs About: Genuine Black Opal And Moissanite Heart Drop Necklace

What makes black opal different from other opals?
Black opal has a dark body tone that enhances its play-of-color, making the flashes of color appear more vivid compared to lighter opals.
Is each black opal heart pendant identical?
No, natural black opals display unique color patterns, so slight variations in play-of-color are expected and part of their appeal.
How should I care for a black opal necklace?
Clean gently with a soft cloth and avoid harsh chemicals. Store separately to help protect the stone’s surface and maintain its color display.
What role does moissanite play in this design?
Moissanite accents provide additional sparkle and contrast, enhancing the visual impact of the darker opal center.
Is a heart drop necklace suitable for gifting?
Yes, the heart motif combined with vibrant opal color makes it a meaningful choice for occasions such as anniversaries or special celebrations.