Flower Inspired Fire Opal Engagement Ring with Diamond

0
Regular price $509
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by nature's romance, fiery color and delicate sparkle unite in this Fire Opal and Diamond Ring designed to leave a lasting impression. At its heart rests a 5MM round cut fire opal, beautifully nestled at the center of sculpted metal petals, forming a rose flower motif that feels both artistic and deeply symbolic. Gracefully wrapping around the finger, the bypass shank is adorned with shimmering diamonds that enhance the floral design while adding brilliance from every angle. The gentle curve of the band creates movement and elegance, making the Fire Opal Engagement Ring as visually captivating as it is comfortable to wear. Perfect for someone who appreciates distinctive design and meaningful details, this Rose Flower Ring makes a remarkable engagement or statement piece. Romantic yet unconventional, it reflects individuality and enduring affection. Whether chosen to mark a proposal or a milestone moment, this Bypass Engagement Ring embodies devotion and artistry, creating a piece that feels personal, expressive, and destined to be cherished for a lifetime.

Product Information
SKU SHP-RINGS0821192909
Width 5 mm
Height 11.5 mm
Metal Weight 2.58 gm (Approximate)
Total Stone Weight 0.68 Carat (Approximate)
FIRE OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Orange
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
fire-opal-engagement-rings